FC920175

Overview
NameFC920175
Unique NameFC920175
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length687
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9238 contig Ccv1_Contig9238:61..748. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: GYAR_THEPD (Glyoxylate reductase OS=Thermofilum pendens (strain Hrk 5) GN=gyaR PE=3 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 5.975e-22
Identity = 60/190 (31.58%), Postives = 100/190 (52.63%), Query Frame = 3
Query:   99 PLHEFLTLHAHSVKAIFSSAGAPVTAEILRLLPEVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVRQGLW--PINAEFPLGSKLGGKRVGIVGLGSIGSEVAKRLEAFGCCVSYNSRNKKPSVTYPF----YPDVCELAANSDVLIICCALTDQTHHLINKQ 650
            P  E L  +     A+       + AE++   P ++++   S G +HID+ E  +RG+ + +   V ++ VA++ +GL++ V R++  AD  +R G W  P N  F  G +L GK +G+VGLG IG   AKRL +F   + Y    ++  V        + D+  L   SD++ I   LT +T+HLIN++
Sbjct:   36 PSREELLRNIRDKDALLCLLTDKIDAEVMDAAPNLKVISTYSVGFDHIDIPEATKRGIYVTHTPGVLTDAVAEFTVGLILAVTRRIVEADKIIRTGQWDKPWNPYFLTGPELKGKTIGLVGLGRIGVATAKRLSSFDVKILYYDIERRWDVETVIPNMEFTDLDTLLEKSDIVSIHVPLTKETYHLINEE 225          
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: GYAR_THEON (Glyoxylate reductase OS=Thermococcus onnurineus (strain NA1) GN=gyaR PE=3 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 1.019e-21
Identity = 63/189 (33.33%), Postives = 98/189 (51.85%), Query Frame = 3
Query:  108 EFLTLHAHSVKAIFSSAGAPVTAEILRLLPEVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVRQGLWPIN--AEFP---LGSKLGGKRVGIVGLGSIGSEVAKRLEAFGCCVSYNSRNKKPSVTYPF---YPDVCELAANSDVLIICCALTDQTHHLINKQ 650
            E L      V A+ +     + AE+    P +++V   + G ++ID+ E  + GV + N  +V +   AD A  LL+   R+L  AD FVR G W     A  P   LG  + G+ +GIVG G IG  +A+R + FG  + YNSR +KP V       +  + EL   SD +++   LT +T+H+IN++
Sbjct:   37 EVLLEKVRDVDALVTMLSERIDAEVFDAAPRLKIVANYAVGYDNIDIEEATKMGVYITNTPDVLTNATADMAWVLLLATARRLIEADKFVRSGEWKKRGVAWHPLMFLGYDVYGRTIGIVGFGRIGQAIARRAKGFGMRILYNSRTRKPEVEKELGAEFMPLDELLKESDFVVLVVPLTKETYHMINEE 225          
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: GYAR_PYRKO (Glyoxylate reductase OS=Pyrococcus kodakaraensis GN=gyaR PE=3 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 3.873e-21
Identity = 60/189 (31.75%), Postives = 97/189 (51.32%), Query Frame = 3
Query:  108 EFLTLHAHSVKAIFSSAGAPVTAEILRLLPEVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVRQGLW-----PINAEFPLGSKLGGKRVGIVGLGSIGSEVAKRLEAFGCCVSYNSRNKKPSVTYPF---YPDVCELAANSDVLIICCALTDQTHHLINKQ 650
            E L      V A+ +     + +E+    P +R+V   + G ++IDV E  RRG+ + N  +V ++  AD+A  LL+   R+L  AD F R G W       +  + LG  + GK +GIVG G IG  VA+R   FG  + Y SR++KP         +  + +L   SD +++   LT +T ++IN++
Sbjct:   37 EVLLKKVRDVDALVTMLSERIDSEVFDAAPRLRIVANYAVGYDNIDVEEATRRGIYVTNTPDVLTDATADFAWTLLLATARRLIEADHFTRSGEWKRRGIAWHPRWFLGYDVYGKTIGIVGFGRIGQAVARRARGFGMRILYYSRSRKPEAEKELGAEFRSLEDLLRESDFVVLAVPLTKETQYMINEE 225          
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: GYAR_THEGJ (Glyoxylate reductase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=gyaR PE=3 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 6.606e-21
Identity = 61/189 (32.28%), Postives = 95/189 (50.26%), Query Frame = 3
Query:  108 EFLTLHAHSVKAIFSSAGAPVTAEILRLLPEVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVRQGLWPIN--AEFP---LGSKLGGKRVGIVGLGSIGSEVAKRLEAFGCCVSYNSRNKKPSVTYPF---YPDVCELAANSDVLIICCALTDQTHHLINKQ 650
            E L      V A+ +     +  E+    P +R+V   + G +++DV E  RRG+ + N  +V +   AD+A  LL+   R+L  AD F R G W     A  P   LG  + GK +GI+G G IG  VA+R + FG  + Y SR +KP         +  + EL   SD +++   LT +T+H+I ++
Sbjct:   37 EVLLEKVRDVDALVTMLSERIDGEVFDNAPRLRIVANYAVGYDNVDVEEATRRGIYVTNTPDVLTNATADFAWTLLLATARRLIEADSFTRSGEWKRKGIAWHPLMFLGHDVYGKTIGIIGFGRIGQAVARRAKGFGMRILYYSRTRKPEAEEELKAEFKPLEELLKESDFVVLAVPLTKETYHMIGER 225          
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: GYAR_THELI (Glyoxylate reductase OS=Thermococcus litoralis GN=gyaR PE=1 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 8.628e-21
Identity = 65/192 (33.85%), Postives = 97/192 (50.52%), Query Frame = 3
Query:  135 VKAIFSSAGAPVTAEILRLLPEVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVRQGLWPINAE-----FPLGSKLGGKRVGIVGLGSIGSEVAKRLEAFGCCVSYNSRNKKPSVTYPF---YPDVCELAANSDVLIICCALTDQTHHLINKQSCWPWGKKELLL 686
            V A+ +     V  E+L   P+++++   + G ++ID+ E  +RG+ + N   V ++  AD A  LL+ V R++  AD FVR G W  +         LG  L GK +GIVG G IG  +AKR + FG  + Y SR +KP         Y D   L   SD + +   LT +T+H+I        G+KEL L
Sbjct:   46 VDALVTLVTDKVDKELLENAPKLKIIAQYAVGYDNIDIEEATKRGIYVTNTPGVLTDATADLAFALLLAVARRIVEADAFVRSGEWKKSEVGWHPLMFLGYGLKGKTLGIVGFGRIGQALAKRAKGFGMKIIYYSRTRKPEAEEEIGAEYVDFETLLKESDFISLHVPLTKETYHMI--------GEKELKL 229          
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: GYAR_PYRHO (Glyoxylate reductase OS=Pyrococcus horikoshii GN=gyaR PE=1 SV=2)

HSP 1 Score: 99.7525 bits (247), Expect = 1.472e-20
Identity = 60/196 (30.61%), Postives = 100/196 (51.02%), Query Frame = 3
Query:   87 ESALPLHEFLTLHAHSVKAIFSSAGAPVTAEILRLLPEVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVRQGLW-----PINAEFPLGSKLGGKRVGIVGLGSIGSEVAKRLEAFGCCVSYNSRNKKPSVTYPF---YPDVCELAANSDVLIICCALTDQTHHLINKQ 650
            E  +P  E L      V A+ +     +  E+    P++R+V   + G ++ID+ E  +RG+ + N  +V ++  AD A  LL+   R +   D FVR G W       + ++ LG  + GK +GI+GLG IG  +AKR + F   + Y SR +K  V       +  + +L   SD +++   LT +T+HLIN++
Sbjct:   31 EKEIP-REILLKKVKEVDALVTMLSERIDKEVFENAPKLRIVANYAVGYDNIDIEEATKRGIYVTNTPDVLTDATADLAFALLLATARHVVKGDRFVRSGEWKKRGVAWHPKWFLGYDVYGKTIGIIGLGRIGQAIAKRAKGFNMRILYYSRTRKEEVERELNAEFKPLEDLLRESDFVVLAVPLTRETYHLINEE 225          
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: GYAR_KORCO (Glyoxylate reductase OS=Korarchaeum cryptofilum (strain OPF8) GN=gyaR PE=3 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 1.922e-20
Identity = 57/193 (29.53%), Postives = 101/193 (52.33%), Query Frame = 3
Query:   87 ESALPLHEFLTLHAHSVKAIFSSAGAPVTAEILRLLPEVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVRQGLWPI--NAEFPLGSKLGGKRVGIVGLGSIGSEVAKRLEAFGCCVSYNSRNKKPSVTYPF---YPDVCELAANSDVLIICCALTDQTHHLINKQ 650
            + A P  + +        A+ S    P+ AE+    P++R+V   + G ++IDV E  +RG+ + N   V +E  AD+A  LL+   R++  AD +VR+G W +  +    LG  + G+ +GIVG+G IG+ VA+R + FG  + Y    ++          Y  + +L   SD + +   LT++T+H+I ++
Sbjct:   30 DEAPPSKKVIIERVKDCDALVSLLTDPIDAEVFEAAPKLRIVAQYAVGYDNIDVKEATKRGIYVTNTPGVLTETTADFAFALLMAAARRVVEADRYVREGKWKVAWHPMMMLGYDVYGRTLGIVGMGRIGAAVARRAKGFGMRILYYDSIRREDFEKELGVEYVPLEKLLEESDFVSLHVPLTEETYHMIGEE 222          
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: GYAR_PYRAB (Glyoxylate reductase OS=Pyrococcus abyssi GN=gyaR PE=3 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 3.279e-20
Identity = 58/189 (30.69%), Postives = 92/189 (48.68%), Query Frame = 3
Query:  108 EFLTLHAHSVKAIFSSAGAPVTAEILRLLPEVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVRQGLW-----PINAEFPLGSKLGGKRVGIVGLGSIGSEVAKRLEAFGCCVSYNSRNKKPSVTYPF---YPDVCELAANSDVLIICCALTDQTHHLINKQ 650
            E L      V A+ +     +  E+    P +R+V   + G ++IDV E  +RG+ + N   V ++  AD A  LL+   R L   D F R G W       + ++ LG  + GK +GI+G G IG  +AKR   F   + Y SR +KP V       +  + EL   SD +++   L  +T+H+IN++
Sbjct:   38 EILLEKVKDVDALVTMLSERIDREVFERAPRLRIVANYAVGYDNIDVEEATKRGIYVTNTPGVLTDATADLAFALLLATARHLVKGDKFTRSGEWKKRGVAWHPKWFLGYDVYGKTIGIIGFGRIGQAIAKRARGFDMRILYYSRTRKPEVEKELNAEFKPLDELLRESDFVVLAVPLNKETYHMINEE 226          
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: GYAR_AERPE (Glyoxylate reductase OS=Aeropyrum pernix GN=gyaR PE=3 SV=2)

HSP 1 Score: 98.5969 bits (244), Expect = 3.279e-20
Identity = 62/191 (32.46%), Postives = 100/191 (52.36%), Query Frame = 3
Query:   99 PLHEFLTLHAHSVKAIFSSAGAPVTAEILRLLPEVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVRQGLW-----PINAEFPLGSKLGGKRVGIVGLGSIGSEVAKRLEAFGCCVSYNSRNKKPSVTYPF---YPDVCELAANSDVLIICCALTDQTHHLINK 647
            P +E L   A    A+++     +  ++L   P +R+V   + G ++IDV    R G+ + N   V +E  A++   L++   R++  AD FVR G W       +    LG +L GK +GI+G+G IGS VA+  +AFG  + Y+SR++K  +       Y  + +L   SD+L I   LTD+T HLI +
Sbjct:   35 PPYETLLSKAREADALYTLLTDRIDCDLLSQAPRLRIVAQMAVGFDNIDVECATRLGIYVTNTPGVLTEATAEFTWALILAAARRVVEADHFVRWGEWWRLRTGWHPMMMLGVELRGKTLGILGMGRIGSRVAEIGKAFGMRIIYHSRSRKREIEKELGAEYRSLEDLLRESDILSIHLPLTDETRHLIGE 225          
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: GYAR_PYRFU (Glyoxylate reductase OS=Pyrococcus furiosus GN=gyaR PE=3 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 3.625e-19
Identity = 65/218 (29.82%), Postives = 105/218 (48.17%), Query Frame = 3
Query:   21 SGFAMLGEQFFTSNKFQYLKAYESALPLHEFLTLHAHSVKAIFSSAGAPVTAEILRLLPEVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVRQGLW-----PINAEFPLGSKLGGKRVGIVGLGSIGSEVAKRLEAFGCCVSYNSRNKKPSVTYPF---YPDVCELAANSDVLIICCALTDQTHHLINKQ 650
            +G  ML E+F        +   E  +P  + L      V A+ +     +  E+    P +R+V   + G ++IDV E  RRG+ + N  +V +   AD+A  LL+   R +   D FVR G W       + ++ LG +L GK +GIVG G IG  +A+R + F   + Y SR +K          Y  + E+   SD +I+   LT +T ++IN++
Sbjct:   14 NGINMLEEEFEVE-----VWEEEREIPREKLLE-KVKDVDALVTMLSERIDQEVFENAPRLRIVANYAVGYDNIDVEEATRRGIYVTNTPDVLTNATADHAFALLLATARHVVKGDKFVRSGEWKRKGIAWHPKWFLGYELYGKTIGIVGFGRIGQAIARRAKGFNMRILYYSRTRKSQAEKELGAEYRPLEEVLKESDFVILAVPLTKETMYMINEE 225          
The following BLAST results are available for this feature:
BLAST of FC920175 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 100
Match NameE-valueIdentityDescription
GYAR_THEPD5.975e-2231.58Glyoxylate reductase OS=Thermofilum pendens (strai... [more]
GYAR_THEON1.019e-2133.33Glyoxylate reductase OS=Thermococcus onnurineus (s... [more]
GYAR_PYRKO3.873e-2131.75Glyoxylate reductase OS=Pyrococcus kodakaraensis G... [more]
GYAR_THEGJ6.606e-2132.28Glyoxylate reductase OS=Thermococcus gammatolerans... [more]
GYAR_THELI8.628e-2133.85Glyoxylate reductase OS=Thermococcus litoralis GN=... [more]
GYAR_PYRHO1.472e-2030.61Glyoxylate reductase OS=Pyrococcus horikoshii GN=g... [more]
GYAR_KORCO1.922e-2029.53Glyoxylate reductase OS=Korarchaeum cryptofilum (s... [more]
GYAR_PYRAB3.279e-2030.69Glyoxylate reductase OS=Pyrococcus abyssi GN=gyaR ... [more]
GYAR_AERPE3.279e-2032.46Glyoxylate reductase OS=Aeropyrum pernix GN=gyaR P... [more]
GYAR_PYRFU3.625e-1929.82Glyoxylate reductase OS=Pyrococcus furiosus GN=gya... [more]

Pages

back to top
Libraries
Library NameType
RVDevelop1cdna_library
Properties
Property NameValue
Genbank descriptionC32005A03EF RVDevelop1 Citrus clementina cDNA clone C32005A03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920175 ID=FC920175|Name=FC920175|organism=Citrus clementina|type=EST|length=687bp
GGCTACTCTTAAGAAAACCATCAGGCTTCGCTATGTTAGGAGAACAGTTC
TTTACCTCAAACAAATTCCAATACTTGAAAGCATACGAATCAGCGCTTCC
TCTACACGAATTCTTGACACTACACGCGCACTCAGTGAAGGCCATCTTCT
CCAGCGCAGGTGCGCCGGTTACAGCCGAAATCCTCCGCCTGCTTCCAGAG
GTGCGGCTGGTGGTTGCCACAAGCGCCGGCCTTAACCATATTGACGTAGT
AGAGTGCCGCCGCCGCGGTGTGGCTCTGGCCAATGCTGGTAACGTTTTCT
CTGAAGACGTGGCTGATTACGCACTGGGCTTGCTAATTGATGTCCTGAGA
AAACTTTCTGCTGCCGATTGCTTTGTCAGACAAGGGCTTTGGCCTATCAA
CGCTGAATTTCCGCTTGGGTCTAAGTTGGGTGGCAAACGAGTTGGGATTG
TTGGGCTGGGGAGCATTGGGTCTGAAGTTGCCAAAAGGCTTGAAGCTTTC
GGCTGCTGCGTTTCATACAACTCTAGGAATAAAAAGCCTTCTGTTACGTA
CCCTTTCTATCCGGATGTCTGTGAACTTGCAGCTAACAGTGATGTCCTCA
TCATTTGCTGTGCATTGACTGATCAAACACATCACTTGATCAATAAGCAG
TCTTGTTGGCCCTGGGGAAAGAAGGAGTTATTATTAA
back to top