FC920178

Overview
NameFC920178
Unique NameFC920178
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length692
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_ARATH (Probable phenylalanyl-tRNA synthetase alpha chain OS=Arabidopsis thaliana GN=At4g39280 PE=2 SV=3)

HSP 1 Score: 374.785 bits (961), Expect = 2.412e-103
Identity = 184/230 (80.00%), Postives = 196/230 (85.22%), Query Frame = 2
Query:    2 KVKDLLLPVQNGHALSKEEISSLKARKLIVPQTWKGYSVRKGPNYAPKRKKAATDLTRENLQKGDWKELEFKEYNFNAKGQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHEXXXXXXXXXXXEWKREEANKNLLRTHTTAVSSRMLKALAEEPFAPKKYFSIDRVFRNEAVDRTHL 691
            KVK  LL +Q G    KE I+SLKARKLIVPQ WKGYSV+KGPNYAP+RKK ATDLTRENLQ  +WKELEFKEYNF AKG P + GHLH LLKVRKQ KDIF+QMGFEEMPTNN+VESSFWNFDALFQPQQHPARDSHDTFFL+ PSTTR LPEDYVERVKRVHE           +WKREEANKNLLRTHTTAVSSRML ALA++PF PKKYFSIDRVFRNEAVDRTHL
Sbjct:  128 KVKGQLLQIQQGKEFDKESINSLKARKLIVPQIWKGYSVKKGPNYAPERKKVATDLTRENLQ--NWKELEFKEYNFKAKGAPVDAGHLHALLKVRKQFKDIFVQMGFEEMPTNNYVESSFWNFDALFQPQQHPARDSHDTFFLKVPSTTRTLPEDYVERVKRVHESGGYGSRGYNYDWKREEANKNLLRTHTTAVSSRMLYALAQKPFVPKKYFSIDRVFRNEAVDRTHL 355          
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_DANRE (Phenylalanyl-tRNA synthetase alpha chain OS=Danio rerio GN=farsa PE=2 SV=2)

HSP 1 Score: 268.085 bits (684), Expect = 3.179e-71
Identity = 134/232 (57.76%), Postives = 163/232 (70.26%), Query Frame = 2
Query:    5 VKDLLLPVQNGHA--LSKEEISSLKARKLIVPQTWKGYSVRKGPNYAPKRKKAATDLTRENLQKGDWKELEFKEYNFNAKGQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHEXXXXXXXXXXXEWKREEANKNLLRTHTTAVSSRMLKALA-EEPFAPKKYFSIDRVFRNEAVDRTHL 691
            V+D L  VQNG +  L ++E + LK RKL+   T K Y + KG +++    K  T+LT E +  G+WKE +FK YNF A G   + GHLHPL+KVR Q + IFL+MGF EMPTNNF+ESSFWNFD+LFQPQQHPARD HDTFF+ +P+   E P DY+ERVK+VH            +WK EEA KNLLRTHTTAVS+RML  LA +E F P KYFSIDRVFRNE +D THL
Sbjct:  136 VRDKLQLVQNGQSAKLEEKEKNELKKRKLLAEVTVKSYWITKGNSFSTTITKQETELTPEMIASGNWKEKKFKPYNFEAMGVAPDCGHLHPLMKVRTQFRQIFLEMGFTEMPTNNFIESSFWNFDSLFQPQQHPARDQHDTFFISDPALAHEFPRDYLERVKKVHSEGGYGSQGYKYDWKIEEAQKNLLRTHTTAVSARMLYKLAQQEKFTPVKYFSIDRVFRNETLDATHL 367          
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_CHICK (Phenylalanyl-tRNA synthetase alpha chain OS=Gallus gallus GN=FARSA PE=1 SV=1)

HSP 1 Score: 263.077 bits (671), Expect = 1.023e-69
Identity = 131/221 (59.28%), Postives = 158/221 (71.49%), Query Frame = 2
Query:   32 NGHALSKEEISSLKARKLIVPQTWKGYSVRKGPNYAPKRKKAATDLTRENLQKGDWKELEFKEYNFNAKGQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHEXXXXXXXXXXXEWKREEANKNLLRTHTTAVSSRMLKALAEE-PFAPKKYFSIDRVFRNEAVDRTHL 691
            NG +LS+ E + LK RKL++  T K Y +RKG  ++    +  TDLT E +  G W++L FK YNF+A G P   GHLHPLLKVR QL+ IFL+MGF EMPT+NFVESSFWNFDALFQPQQHPARD HDTFFL++P+   ELP +Y+ RVK+VH            EWK EEA KNLLRTHTT+ S+R L  LA +  F P KYFSIDRVFRNE++D THL
Sbjct:  150 NGGSLSERERTDLKRRKLLLEVTLKSYWIRKGSAFSTAVVRQETDLTPEMIATGSWRKLPFKAYNFSALGLPPTCGHLHPLLKVRSQLRQIFLEMGFTEMPTDNFVESSFWNFDALFQPQQHPARDQHDTFFLQDPAEAPELPANYMARVKKVHSQGGYGSQGYKYEWKVEEARKNLLRTHTTSASARALYHLARQGKFTPVKYFSIDRVFRNESLDATHL 370          
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFAB_XENLA (Phenylalanyl-tRNA synthetase alpha chain B OS=Xenopus laevis GN=farsa-B PE=2 SV=1)

HSP 1 Score: 258.84 bits (660), Expect = 1.929e-68
Identity = 131/232 (56.47%), Postives = 160/232 (68.97%), Query Frame = 2
Query:    5 VKDLLLPVQNGHA--LSKEEISSLKARKLIVPQTWKGYSVRKGPNYAPKRKKAATDLTRENLQKGDWKELEFKEYNFNAKGQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHEXXXXXXXXXXXEWKREEANKNLLRTHTTAVSSRMLKALA-EEPFAPKKYFSIDRVFRNEAVDRTHL 691
            VK+ L  +  G A  +++++ + LK RKL+   T K Y V KG  ++    K  TDLT E +  G W+E +FK YNFNA G   E GHLHPLLKVR Q + IFL+MGF EMPTNNF+ESSFWNFDALFQPQQHPARD HDTFFL++P+   E P +Y+ERVK+VH            +W   EA KN+LRTHTTAVS+RML  LA ++ F P KYFSIDRVFRNE +D THL
Sbjct:  137 VKEKLQLILKGRADDVNEKDKNELKKRKLVNEVTVKSYWVTKGSGFSTSITKQETDLTPEMIASGSWREKQFKGYNFNALGVMPECGHLHPLLKVRTQFRQIFLEMGFTEMPTNNFIESSFWNFDALFQPQQHPARDQHDTFFLQDPALATEFPMEYLERVKKVHSEGGYGSQGYKYDWSIHEAQKNILRTHTTAVSARMLYKLAHQKEFTPVKYFSIDRVFRNETLDATHL 368          
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_DROME (Probable phenylalanyl-tRNA synthetase alpha chain OS=Drosophila melanogaster GN=CG2263 PE=2 SV=1)

HSP 1 Score: 257.299 bits (656), Expect = 5.611e-68
Identity = 126/221 (57.01%), Postives = 154/221 (69.68%), Query Frame = 2
Query:   35 GHALSKEEISSLKARKLIVPQTWKGYSVRKGPNYAPKRKKAATDLTRENLQKGDWKELEFKEYNFNAKGQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHEXXXXXXXXXXXEWKREEANKNLLRTHTTAVSSRMLKALA--EEPFAPKKYFSIDRVFRNEAVDRTHL 691
            G  L  +E++  K RKL+   T K + + +GP +A    K  TDLT E L  G W +L+FK YNF+A G P   GHLHPLLKVR + + IFL+MGF EMPTNN+VESSFWNFDAL+QPQQHPARD+HDTFF+  P+ + + P+DY+ERVK+VH            +WK EEA KNLLRTHTTAVS+RML  LA  E  F   KYFSID+VFRNE +D THL
Sbjct:  147 GDQLPAKEVADFKKRKLLQETTTKSFVLARGPEFATTLTKLETDLTVEMLANGLWDQLKFKAYNFDALGAPPTRGHLHPLLKVRTEFRQIFLEMGFSEMPTNNYVESSFWNFDALYQPQQHPARDAHDTFFVNHPAKSHKFPQDYLERVKKVHSVGGYGSKGYGYDWKLEEAQKNLLRTHTTAVSARMLYKLANQEGGFKAAKYFSIDKVFRNETLDATHL 367          
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFAA_XENLA (Phenylalanyl-tRNA synthetase alpha chain A OS=Xenopus laevis GN=farsa-A PE=2 SV=1)

HSP 1 Score: 256.914 bits (655), Expect = 7.329e-68
Identity = 130/232 (56.03%), Postives = 160/232 (68.97%), Query Frame = 2
Query:    5 VKDLLLPVQNGHA--LSKEEISSLKARKLIVPQTWKGYSVRKGPNYAPKRKKAATDLTRENLQKGDWKELEFKEYNFNAKGQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHEXXXXXXXXXXXEWKREEANKNLLRTHTTAVSSRMLKALA-EEPFAPKKYFSIDRVFRNEAVDRTHL 691
            VK+ L  +  G A  +++++ + LK RKL+   T K Y V KG  ++    K  TDLT E +  G W+E +FK YNF+A G   E GHLHPLLKVR Q + IFL+MGF EMPTNNF+ESSFWNFDALFQPQQHPARD HDTFFL++P+   E P +Y+ERVK+VH            +W   EA KN+LRTHTTAVS+RML  LA ++ F P KYFSIDRVFRNE +D THL
Sbjct:  137 VKEKLQLILKGRADDVNEKDRNELKKRKLVNEVTVKSYWVTKGSGFSTSITKQETDLTPEMIASGSWREKQFKGYNFDALGVMPECGHLHPLLKVRTQFRQIFLEMGFTEMPTNNFIESSFWNFDALFQPQQHPARDQHDTFFLQDPALATEFPMEYLERVKKVHSEGGYGSQGYKYDWSIHEAQKNILRTHTTAVSARMLYKLALQKDFTPVKYFSIDRVFRNETLDATHL 368          
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_RAT (Phenylalanyl-tRNA synthetase alpha chain OS=Rattus norvegicus GN=Farsa PE=1 SV=1)

HSP 1 Score: 253.832 bits (647), Expect = 6.204e-67
Identity = 128/233 (54.94%), Postives = 158/233 (67.81%), Query Frame = 2
Query:    2 KVKDLLLPVQNGHA--LSKEEISSLKARKLIVPQTWKGYSVRKGPNYAPKRKKAATDLTRENLQKGDWKELEFKEYNFNAKGQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHEXXXXXXXXXXXEWKREEANKNLLRTHTTAVSSRMLKALAE-EPFAPKKYFSIDRVFRNEAVDRTHL 691
            +V+  L  VQ G A  L+++E + L+ RKL+     K Y V KG  ++    K   +L+ E +  G W++  FK YNF+A+G   + GHLHPLLKVR Q + IFL+MGF EMPT+NF+ESSFWNFDALFQPQQHPARD HDTFFL +P+   +LP DYV+RVKR H             WK EEA KNLLRTHTTA S+R L  LA+ +PF P KYFSIDRVFRNE +D THL
Sbjct:  135 EVQRRLQQVQAGQAEKLAEKERNELRKRKLLTEVILKTYWVSKGKGFSTSVSKQEAELSPEMISSGSWRDRPFKPYNFSARGVLPDSGHLHPLLKVRSQFRQIFLEMGFTEMPTDNFIESSFWNFDALFQPQQHPARDQHDTFFLRDPAEALQLPMDYVQRVKRTHSQGGYGSQGYKYTWKLEEARKNLLRTHTTAASARALYRLAQKKPFTPAKYFSIDRVFRNETLDATHL 367          
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_HUMAN (Phenylalanyl-tRNA synthetase alpha chain OS=Homo sapiens GN=FARSA PE=1 SV=3)

HSP 1 Score: 251.521 bits (641), Expect = 3.079e-66
Identity = 128/233 (54.94%), Postives = 157/233 (67.38%), Query Frame = 2
Query:    2 KVKDLLLPVQNGHA--LSKEEISSLKARKLIVPQTWKGYSVRKGPNYAPKRKKAATDLTRENLQKGDWKELEFKEYNFNAKGQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHEXXXXXXXXXXXEWKREEANKNLLRTHTTAVSSRMLKALAE-EPFAPKKYFSIDRVFRNEAVDRTHL 691
            +V+  L  V+ G A  L ++E S L+ RKL+   T K Y V KG  ++    K  T+L+ E +  G W++  FK YNF A G   + GHLHPLLKVR Q + IFL+MGF EMPT+NF+ESSFWNFDALFQPQQHPARD HDTFFL +P+   +LP DYV+RVKR H             WK +EA KNLLRTHTT+ S+R L  LA+ +PF P KYFSIDRVFRNE +D THL
Sbjct:  135 EVQRRLQLVRGGQAEKLGEKERSELRKRKLLAEVTLKTYWVSKGSAFSTSISKQETELSPEMISSGSWRDRPFKPYNFLAHGVLPDSGHLHPLLKVRSQFRQIFLEMGFTEMPTDNFIESSFWNFDALFQPQQHPARDQHDTFFLRDPAEALQLPMDYVQRVKRTHSQGGYGSQGYKYNWKLDEARKNLLRTHTTSASARALYRLAQKKPFTPVKYFSIDRVFRNETLDATHL 367          
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_MOUSE (Phenylalanyl-tRNA synthetase alpha chain OS=Mus musculus GN=Farsa PE=2 SV=1)

HSP 1 Score: 249.98 bits (637), Expect = 8.958e-66
Identity = 127/233 (54.51%), Postives = 157/233 (67.38%), Query Frame = 2
Query:    2 KVKDLLLPVQNGHA--LSKEEISSLKARKLIVPQTWKGYSVRKGPNYAPKRKKAATDLTRENLQKGDWKELEFKEYNFNAKGQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHEXXXXXXXXXXXEWKREEANKNLLRTHTTAVSSRMLKALAE-EPFAPKKYFSIDRVFRNEAVDRTHL 691
            +V+  L  VQ G A  L+++E + L+ RKL+     K Y V KG  ++    K   +L+ E +  G W++  FK YNF+A+G   + GHLHPLLKVR Q + IFL+MGF EMPT+NF+ESSFWNFDALFQPQQHPARD HDTFFL +P+   +LP  YV+RVKR H             WK EEA KNLLRTHTTA S+R L  LA+ +PF P KYFSIDRVFRNE +D THL
Sbjct:  135 EVQKRLQLVQAGQAEKLAEKERNELRKRKLLTEVILKTYWVSKGKAFSTSVSKQEAELSPEMISSGSWRDRPFKPYNFSARGVLPDSGHLHPLLKVRSQFRQIFLEMGFTEMPTDNFIESSFWNFDALFQPQQHPARDQHDTFFLRDPAEALQLPMGYVQRVKRTHSQGGYGSQGYKYTWKLEEARKNLLRTHTTAASARALYQLAQKKPFTPAKYFSIDRVFRNETLDATHL 367          
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_PONAB (Phenylalanyl-tRNA synthetase alpha chain OS=Pongo abelii GN=FARSA PE=2 SV=1)

HSP 1 Score: 249.21 bits (635), Expect = 1.528e-65
Identity = 127/233 (54.51%), Postives = 156/233 (66.95%), Query Frame = 2
Query:    2 KVKDLLLPVQNGHA--LSKEEISSLKARKLIVPQTWKGYSVRKGPNYAPKRKKAATDLTRENLQKGDWKELEFKEYNFNAKGQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHEXXXXXXXXXXXEWKREEANKNLLRTHTTAVSSRMLKALAE-EPFAPKKYFSIDRVFRNEAVDRTHL 691
            +V+  L  V+ G A  L ++E S L+ RKL+     K Y V KG  ++    K  T+L+ E +  G W++  FK YNF A G   + GHLHPLLKVR Q + IFL+MGF EMPT+NF+ESSFWNFDALFQPQQHPARD HDTFFL +P+   +LP DYV+RVKR H             WK +EA KNLLRTHTT+ S+R L  LA+ +PF P KYFSIDRVFRNE +D THL
Sbjct:  135 EVQRRLQLVRGGQAEKLGEKERSELRKRKLLAEVILKTYWVSKGSAFSTSISKQETELSPEMISSGSWRDRPFKPYNFLAHGVLPDSGHLHPLLKVRSQFRQIFLEMGFTEMPTDNFIESSFWNFDALFQPQQHPARDQHDTFFLRDPAEALQLPMDYVQRVKRTHSQGGYGSQGYKYNWKLDEARKNLLRTHTTSASARALYRLAQKKPFTPVKYFSIDRVFRNETLDATHL 367          
The following BLAST results are available for this feature:
BLAST of FC920178 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 74
Match NameE-valueIdentityDescription
SYFA_ARATH2.412e-10380.00Probable phenylalanyl-tRNA synthetase alpha chain ... [more]
SYFA_DANRE3.179e-7157.76Phenylalanyl-tRNA synthetase alpha chain OS=Danio ... [more]
SYFA_CHICK1.023e-6959.28Phenylalanyl-tRNA synthetase alpha chain OS=Gallus... [more]
SYFAB_XENLA1.929e-6856.47Phenylalanyl-tRNA synthetase alpha chain B OS=Xeno... [more]
SYFA_DROME5.611e-6857.01Probable phenylalanyl-tRNA synthetase alpha chain ... [more]
SYFAA_XENLA7.329e-6856.03Phenylalanyl-tRNA synthetase alpha chain A OS=Xeno... [more]
SYFA_RAT6.204e-6754.94Phenylalanyl-tRNA synthetase alpha chain OS=Rattus... [more]
SYFA_HUMAN3.079e-6654.94Phenylalanyl-tRNA synthetase alpha chain OS=Homo s... [more]
SYFA_MOUSE8.958e-6654.51Phenylalanyl-tRNA synthetase alpha chain OS=Mus mu... [more]
SYFA_PONAB1.528e-6554.51Phenylalanyl-tRNA synthetase alpha chain OS=Pongo ... [more]

Pages

back to top
Libraries
Library NameType
RVDevelop1cdna_library
Properties
Property NameValue
Genbank descriptionC32005A06EF RVDevelop1 Citrus clementina cDNA clone C32005A06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920178 ID=FC920178|Name=FC920178|organism=Citrus clementina|type=EST|length=692bp
AAAAGTCAAAGATTTGCTTCTACCAGTACAAAATGGACATGCGCTTAGCA
AAGAGGAGATTAGCAGTCTCAAAGCACGGAAGCTTATTGTTCCCCAGACA
TGGAAGGGGTACTCAGTGAGAAAAGGTCCTAATTATGCTCCCAAAAGGAA
GAAAGCTGCTACAGATTTGACTCGAGAGAACCTTCAGAAGGGTGATTGGA
AGGAATTGGAGTTCAAAGAGTACAACTTCAATGCTAAAGGACAGCCTGCG
GAAGGTGGCCATCTTCACCCACTGCTCAAGGTGCGGAAGCAATTGAAGGA
CATATTTCTCCAGATGGGTTTTGAGGAGATGCCGACAAACAATTTTGTTG
AAAGCAGCTTCTGGAACTTTGATGCATTATTCCAGCCACAACAACACCCT
GCCCGTGATTCTCATGATACCTTCTTTCTGGAAGAACCTTCCACTACAAG
GGAACTACCAGAAGATTATGTTGAGCGGGTGAAGCGTGTGCACGAGTCTG
GTGGTTATGGGTCCAGAGGATATGGATATGAGTGGAAAAGAGAGGAAGCA
AACAAAAACCTTCTGCGAACTCATACAACTGCTGTCTCTTCCAGGATGCT
TAAGGCACTAGCTGAAGAACCTTTTGCCCCGAAAAAGTATTTCTCCATAG
ATCGTGTTTTCAGAAATGAAGCTGTTGATCGAACTCATCTTG
back to top