FC920185

Overview
NameFC920185
Unique NameFC920185
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length707
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14099 contig Ccv1_Contig14099:139..845. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920185 vs. ExPASy Swiss-Prot
Match: RSC5_DICDI (Random slug protein 5 OS=Dictyostelium discoideum GN=rsc5 PE=2 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 2.414e-13
Identity = 52/194 (26.80%), Postives = 91/194 (46.91%), Query Frame = 1
Query:  127 QKVNYERAEAVLKLLTKKSPLSVKQE-KFCGRGCVDRFLRSKGDNVKKAAKQLRACLSWRESIGIDNLTADEFSAELAE-GVAYVAGHDDESRPVVVFRIKQDYQKFHSQKLFTRLLVFTLEVAVATMS--KNVEQFVLLFDXXXXXXXXXXMNLLLTTLKIVAEYYPGRLYKAFVIDPPSLFAYLWKGVRPFV 696
            + +N ++ EA  ++ +  S L+   +  FC   C  R+LR++   V K+ K LR  L WR+     ++       E+   G  YV   D + RP++    + D  K    +L  + LV+ LE   + M   K +EQF  + D          M   L  +  + ++ P R+ ++  +DPP+LF + WK + PF+
Sbjct:   42 KNLNEKQLEAFKEIKSNFSDLTDPTDIAFCTDMCFLRYLRARNYIVSKSEKMLRDTLEWRKKFRPQDIQLGGDIREIGSAGCVYVNKRDKKGRPIIFAVPRNDTLKNVPSELKFKNLVYWLEQGFSRMDEPKGIEQFCFIVDYKDFGSGNMDMKTNLEAMHFLLDHCPERMGQSLFLDPPALFWFAWKIISPFL 235          
BLAST of FC920185 vs. ExPASy Swiss-Prot
Match: YJX4_SCHPO (CRAL-TRIO domain-containing protein C23B6.04c OS=Schizosaccharomyces pombe GN=SPCC23B6.04c PE=1 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 5.034e-11
Identity = 51/177 (28.81%), Postives = 82/177 (46.33%), Query Frame = 1
Query:  172 TKKSPLSVKQEKFCGRGCVDRFLRSKGDNVKKAAKQLRACLSWRESIGIDNLTADEFSAELAEGVAYVAGHDDESRPVVVFRIKQDYQKFHSQKLFTRLLVFTLEVAVATMSKNVEQFVLLFD-XXXXXXXXXXMNLLLTTLKIVAEYYPGRLYKAFVIDPPSLFAYLWKGVRPFVE 699
            +KK+ L   +  +  R C+ R+LR+   +V  A K++   L WR   G++N+  DE   E A G   + G+D + RP +   +    Q   +  L  R LVF+LE A+  M   VE   LL +           +      L I+  +Y  RL +A VI+ P      +K + PF++
Sbjct:  620 SKKTDLIELERLWLTRECILRYLRATKWHVSNAKKRIVDTLVWRRHFGVNNMDPDEIQEENATGKQVLLGYDKDGRPCLY--LYPARQNTKTSPLQIRHLVFSLECAIDLMPPGVETLALLINFKSSSNRSNPSVGQGKEVLNILQTHYCERLGRALVINIPWAVWGFFKLISPFID 794          
The following BLAST results are available for this feature:
BLAST of FC920185 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
RSC5_DICDI2.414e-1326.80Random slug protein 5 OS=Dictyostelium discoideum ... [more]
YJX4_SCHPO5.034e-1128.81CRAL-TRIO domain-containing protein C23B6.04c OS=S... [more]
back to top
Libraries
Library NameType
RVDevelop1cdna_library
Properties
Property NameValue
Genbank descriptionC32005B01EF RVDevelop1 Citrus clementina cDNA clone C32005B01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920185 ID=FC920185|Name=FC920185|organism=Citrus clementina|type=EST|length=707bp
GAAGTTTTTAATGGTTGCGTGACCCAGAAGTTTGGTATATTTGCTCTGTT
CAGATTATTCTCACAATCAGTTCATCGCTTGGAGTATTATCTCTTTCTCG
AAATGGGGAAGAAAGAAGTGCAAGATCAAAAAGTAAACTACGAAAGAGCT
GAAGCTGTTCTCAAACTTCTCACAAAAAAATCCCCTCTTTCAGTGAAACA
GGAGAAGTTCTGCGGCAGAGGTTGTGTAGATCGGTTCTTGAGATCAAAAG
GTGATAACGTGAAGAAGGCTGCGAAGCAGTTAAGGGCTTGCCTTTCTTGG
AGAGAGAGCATTGGCATTGATAATTTGACAGCAGACGAGTTCTCAGCTGA
ACTAGCTGAAGGGGTTGCTTATGTTGCTGGTCATGATGATGAATCCAGAC
CCGTTGTGGTTTTCAGGATTAAGCAAGACTACCAGAAGTTCCATTCTCAA
AAACTGTTCACTCGTTTGCTTGTTTTTACCCTTGAGGTGGCCGTTGCTAC
AATGTCCAAAAACGTTGAACAATTTGTTCTCCTCTTTGATGCAAGCTTTT
TCAGATCCGCCTCAGCTTTTATGAATTTATTGCTGACAACACTGAAAATT
GTGGCCGAGTATTACCCAGGAAGGCTTTACAAAGCTTTTGTCATCGATCC
ACCTTCTCTTTTTGCTTATCTGTGGAAGGGTGTCCGTCCATTTGTTGAGC
TATCAAC
back to top