FC920191

Overview
NameFC920191
Unique NameFC920191
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length723
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig442 contig Ccv1_Contig442:525..1247. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920191 vs. ExPASy Swiss-Prot
Match: RL31_ARATH (60S ribosomal protein L3-1 OS=Arabidopsis thaliana GN=ARP1 PE=2 SV=5)

HSP 1 Score: 261.922 bits (668), Expect = 2.443e-69
Identity = 121/137 (88.32%), Postives = 133/137 (97.08%), Query Frame = 3
Query:    3 RKMKGLKQKKAHLMEIQVNGGSVAQKVDFAYGFFEKQIPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRS 413
            RKMKGLKQKKAH+MEIQ+NGG++AQKVDFAY FFEKQIPI+AVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVS+TVARAGQNGYHHRTE+NKKIY+LGK   E+H+AMTE+DR+
Sbjct:  169 RKMKGLKQKKAHMMEIQINGGTIAQKVDFAYSFFEKQIPIEAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSYTVARAGQNGYHHRTELNKKIYRLGKVGTEAHTAMTEYDRT 305          
BLAST of FC920191 vs. ExPASy Swiss-Prot
Match: RL3_ORYSJ (60S ribosomal protein L3 OS=Oryza sativa subsp. japonica GN=RPL3 PE=2 SV=2)

HSP 1 Score: 261.151 bits (666), Expect = 4.167e-69
Identity = 120/137 (87.59%), Postives = 132/137 (96.35%), Query Frame = 3
Query:    3 RKMKGLKQKKAHLMEIQVNGGSVAQKVDFAYGFFEKQIPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRS 413
            RKMKGLKQKKAHLMEIQ+NGG++A KVD+ Y FFEK+IP+DAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVS+TVARAGQNGYHHRTEMNKK+YK+GK+ QESH+A TEFDR+
Sbjct:  169 RKMKGLKQKKAHLMEIQINGGTIADKVDYGYKFFEKEIPVDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSYTVARAGQNGYHHRTEMNKKVYKIGKSGQESHAACTEFDRT 305          
BLAST of FC920191 vs. ExPASy Swiss-Prot
Match: RL32_ARATH (60S ribosomal protein L3-2 OS=Arabidopsis thaliana GN=ARP2 PE=2 SV=4)

HSP 1 Score: 254.603 bits (649), Expect = 3.900e-67
Identity = 116/137 (84.67%), Postives = 130/137 (94.89%), Query Frame = 3
Query:    3 RKMKGLKQKKAHLMEIQVNGGSVAQKVDFAYGFFEKQIPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRS 413
            RKMKGLKQKKAHL EIQ+NGG +A+KVD+A   FEKQ+P+DA+FQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVS+TVARAGQNGYHHRTEMNKK+Y++GK  QE+HSAMTE+DR+
Sbjct:  169 RKMKGLKQKKAHLNEIQINGGDIAKKVDYACSLFEKQVPVDAIFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSYTVARAGQNGYHHRTEMNKKVYRVGKVGQETHSAMTEYDRT 305          
BLAST of FC920191 vs. ExPASy Swiss-Prot
Match: RL3_ASPFU (60S ribosomal protein L3 OS=Aspergillus fumigatus GN=rpl3 PE=1 SV=2)

HSP 1 Score: 196.438 bits (498), Expect = 1.261e-49
Identity = 92/132 (69.70%), Postives = 109/132 (82.58%), Query Frame = 3
Query:   18 LKQKKAHLMEIQVNGGSVAQKVDFAYGFFEKQIPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRS 413
            LKQKKAHLMEIQVNGGSVA KVDFA   FEK I ID++F+KDEMID+I VTKG G++GV +RWG  +LPRKTH+GLRKVACIGAWHP+ V +TVARAGQ GYHHRT  N K++++GK S E  +A T+FD S
Sbjct:  172 LKQKKAHLMEIQVNGGSVADKVDFARNLFEKPIEIDSIFEKDEMIDVIAVTKGHGFQGVTSRWGTKKLPRKTHKGLRKVACIGAWHPSHVQWTVARAGQMGYHHRTSCNHKVFRIGKGSDEG-NASTDFDIS 302          
BLAST of FC920191 vs. ExPASy Swiss-Prot
Match: RL3_MOUSE (60S ribosomal protein L3 OS=Mus musculus GN=Rpl3 PE=2 SV=2)

HSP 1 Score: 194.126 bits (492), Expect = 6.256e-49
Identity = 92/138 (66.67%), Postives = 114/138 (82.61%), Query Frame = 3
Query:   18 LKQKKAHLMEIQVNGGSVAQKVDFAYGFFEKQIPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGK------ASQESHSAMTEFDRS 413
            L+QKKAHLMEIQVNGG+VA+K+D+A    E+Q+P++ VF +DEMID+IGVTKGKGY+GV +RW   +LPRKTHRGLRKVACIGAWHPARV+FTVARAGQ GYHHRTE+NKKIYK+G+           ++A T++D S
Sbjct:  173 LRQKKAHLMEIQVNGGTVAEKLDWARERLEQQVPVNQVFGQDEMIDVIGVTKGKGYKGVTSRWHTKKLPRKTHRGLRKVACIGAWHPARVAFTVARAGQKGYHHRTEINKKIYKIGQGYLIKDGKLIKNNASTDYDLS 310          
BLAST of FC920191 vs. ExPASy Swiss-Prot
Match: RL3_NEUCR (60S ribosomal protein L3 OS=Neurospora crassa GN=rpl-3 PE=3 SV=1)

HSP 1 Score: 193.356 bits (490), Expect = 1.067e-48
Identity = 89/130 (68.46%), Postives = 106/130 (81.54%), Query Frame = 3
Query:   18 LKQKKAHLMEIQVNGGSVAQKVDFAYGFFEKQIPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFD 407
            LKQKKAHLMEIQ+NGGSVA KV+F +G FEK + ID++F+KDE+ID+I VTKG G+ GV  RWG  +LPRKTH+GLRKVACIGAWHP+ V +TVARAGQ GYHHRT +N KIY++GK   E  SA TE D
Sbjct:  172 LKQKKAHLMEIQINGGSVADKVEFGHGLFEKPVSIDSIFEKDEVIDVIAVTKGHGFTGVTARWGTKKLPRKTHKGLRKVACIGAWHPSHVQWTVARAGQAGYHHRTSVNHKIYRIGKGDAED-SAATEVD 300          
BLAST of FC920191 vs. ExPASy Swiss-Prot
Match: RL3_DEBHA (60S ribosomal protein L3 OS=Debaryomyces hansenii GN=RPL3 PE=3 SV=1)

HSP 1 Score: 193.356 bits (490), Expect = 1.067e-48
Identity = 91/136 (66.91%), Postives = 108/136 (79.41%), Query Frame = 3
Query:    6 KMKGLKQKKAHLMEIQVNGGSVAQKVDFAYGFFEKQIPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRS 413
            K   L QKKAHL EIQVNGGSV+ KVD+A   FEK + +D+VF+KDEM+D+  VTKG G+EGV  RWG  +LPRKTHRGLRKVACIGAWHPA V +TVARAGQNG+HHRT +N K+Y++G A  ES S  TEFDR+
Sbjct:  167 KKTPLAQKKAHLAEIQVNGGSVSDKVDWAKEHFEKTVSVDSVFEKDEMVDVAAVTKGHGFEGVTHRWGTKKLPRKTHRGLRKVACIGAWHPANVQWTVARAGQNGFHHRTSINHKVYRVGSAGDES-SGATEFDRT 301          
BLAST of FC920191 vs. ExPASy Swiss-Prot
Match: RL3_RAT (60S ribosomal protein L3 OS=Rattus norvegicus GN=Rpl3 PE=1 SV=3)

HSP 1 Score: 192.586 bits (488), Expect = 1.820e-48
Identity = 91/138 (65.94%), Postives = 114/138 (82.61%), Query Frame = 3
Query:   18 LKQKKAHLMEIQVNGGSVAQKVDFAYGFFEKQIPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGK------ASQESHSAMTEFDRS 413
            L+QKKAHLMEIQVNGG+VA+K+D+A    E+Q+P++ VF +DEMID+IGVTKGKGY+GV +RW   +LPRKTHRGLRKVACIGAWHPARV+F+VARAGQ GYHHRTE+NKKIYK+G+           ++A T++D S
Sbjct:  173 LRQKKAHLMEIQVNGGTVAEKLDWARERLEQQVPVNQVFGQDEMIDVIGVTKGKGYKGVTSRWHTKKLPRKTHRGLRKVACIGAWHPARVAFSVARAGQKGYHHRTEINKKIYKIGQGYLIKDGKLIKNNASTDYDLS 310          
BLAST of FC920191 vs. ExPASy Swiss-Prot
Match: RL3_HUMAN (60S ribosomal protein L3 OS=Homo sapiens GN=RPL3 PE=1 SV=2)

HSP 1 Score: 192.586 bits (488), Expect = 1.820e-48
Identity = 91/138 (65.94%), Postives = 114/138 (82.61%), Query Frame = 3
Query:   18 LKQKKAHLMEIQVNGGSVAQKVDFAYGFFEKQIPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGK------ASQESHSAMTEFDRS 413
            L+QKKAHLMEIQVNGG+VA+K+D+A    E+Q+P++ VF +DEMID+IGVTKGKGY+GV +RW   +LPRKTHRGLRKVACIGAWHPARV+F+VARAGQ GYHHRTE+NKKIYK+G+           ++A T++D S
Sbjct:  173 LRQKKAHLMEIQVNGGTVAEKLDWARERLEQQVPVNQVFGQDEMIDVIGVTKGKGYKGVTSRWHTKKLPRKTHRGLRKVACIGAWHPARVAFSVARAGQKGYHHRTEINKKIYKIGQGYLIKDGKLIKNNASTDYDLS 310          
BLAST of FC920191 vs. ExPASy Swiss-Prot
Match: RL3_ASHGO (60S ribosomal protein L3 OS=Ashbya gossypii GN=RPL3 PE=3 SV=1)

HSP 1 Score: 192.586 bits (488), Expect = 1.820e-48
Identity = 89/132 (67.42%), Postives = 110/132 (83.33%), Query Frame = 3
Query:   18 LKQKKAHLMEIQVNGGSVAQKVDFAYGFFEKQIPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRS 413
            L QKKAHL EIQ+NGGSV++KVD+A   FEK + +D+VF+++EMID+I VTKG G+EGV  RWG  +LPRKTHRGLRKVACIGAWHPA V +TVARAGQNGYHHRT +N K+Y++GK   E ++A TEFDR+
Sbjct:  172 LVQKKAHLAEIQLNGGSVSEKVDWAREHFEKTVSVDSVFEQNEMIDVIAVTKGHGFEGVTHRWGTKKLPRKTHRGLRKVACIGAWHPAHVMWTVARAGQNGYHHRTSINHKVYRIGKGGDEGNAA-TEFDRT 302          
The following BLAST results are available for this feature:
BLAST of FC920191 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 84
Match NameE-valueIdentityDescription
RL31_ARATH2.443e-6988.3260S ribosomal protein L3-1 OS=Arabidopsis thaliana... [more]
RL3_ORYSJ4.167e-6987.5960S ribosomal protein L3 OS=Oryza sativa subsp. ja... [more]
RL32_ARATH3.900e-6784.6760S ribosomal protein L3-2 OS=Arabidopsis thaliana... [more]
RL3_ASPFU1.261e-4969.7060S ribosomal protein L3 OS=Aspergillus fumigatus ... [more]
RL3_MOUSE6.256e-4966.6760S ribosomal protein L3 OS=Mus musculus GN=Rpl3 P... [more]
RL3_NEUCR1.067e-4868.4660S ribosomal protein L3 OS=Neurospora crassa GN=r... [more]
RL3_DEBHA1.067e-4866.9160S ribosomal protein L3 OS=Debaryomyces hansenii ... [more]
RL3_RAT1.820e-4865.9460S ribosomal protein L3 OS=Rattus norvegicus GN=R... [more]
RL3_HUMAN1.820e-4865.9460S ribosomal protein L3 OS=Homo sapiens GN=RPL3 P... [more]
RL3_ASHGO1.820e-4867.4260S ribosomal protein L3 OS=Ashbya gossypii GN=RPL... [more]

Pages

back to top
Libraries
Library NameType
RVDevelop1cdna_library
Properties
Property NameValue
Genbank descriptionC32005B10EF RVDevelop1 Citrus clementina cDNA clone C32005B10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920191 ID=FC920191|Name=FC920191|organism=Citrus clementina|type=EST|length=723bp
GCAGAAAAATGAAGGGACTGAAGCAGAAGAAGGCCCATCTGATGGAGATC
CAGGTCAATGGTGGATCAGTTGCCCAGAAGGTTGACTTTGCTTATGGTTT
CTTCGAGAAACAGATTCCTATTGATGCTGTGTTCCAGAAAGATGAGATGA
TTGACATTATTGGTGTGACCAAAGGTAAGGGATATGAGGGTGTTGTTACT
CGTTGGGGTGTTACTCGTCTCCCTCGTAAGACTCACCGTGGTCTACGCAA
GGTTGCTTGTATTGGTGCCTGGCATCCGGCTAGGGTCTCCTTTACTGTTG
CTAGAGCTGGGCAGAACGGTTACCATCACCGTACAGAGATGAACAAGAAA
ATTTACAAGCTTGGGAAGGCCAGCCAGGAGTCTCATTCTGCCATGACTGA
ATTTGACAGGTCGGTATATCTGTTATCTTCTTTAATGGGTTCTTTTTCTT
CTTGAGATCTATATTGTTTATTTTAGGTGTATGTGAATTGTTAAGTTGGG
TGAGTTCGAGTAAGGTTGGGTAAGAGCGGGTGGGAACTAGTTGATATTTT
TCCAACCTTTTTTGTTGACCTTTTCTGACCTTTGTTGGCCCCTGCACTTA
AAAAACCGCCAGGTACATGTTTGGCTCCATTTTGTGGCTGAATATTTTTT
TTTATTGTATTATATAGTCATTTCATCATTTAAAGCATGTGGACAGCTGT
CAAGACTTTGCAGTATTCATAGC
back to top