FC920194

Overview
NameFC920194
Unique NameFC920194
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length660
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14094 contig Ccv1_Contig14094:1..661. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920194 vs. ExPASy Swiss-Prot
Match: 2NPD_STAAT (Probable 2-nitropropane dioxygenase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=USA300HOU_0879 PE=3 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 1.404e-17
Identity = 51/127 (40.16%), Postives = 78/127 (61.42%), Query Frame = 2
Query:  269 NIKAILSEKVAVLQVSWGEYSEELVLEAHSAGVKVVPQVGSFDEARKAVNAGVDAIIVQGREAGGH---------VIGQDGLISLLPMVVDLIGDRDIPIIAAGGIVDARGYVAALSLGAQGICLGT 622
            +I  I+ ++V V   ++G  SE+++    +A VK++    S DEA     AG+DAI+ QG EAGGH          +   G ISL+P +VD++    IP+IAAGGI+D RG +A++ LGA+G+ +GT
Sbjct:  117 HIDTIIKKQVPVCCFTFGIPSEQIISRLKAANVKLIGTATSVDEAIANEKAGMDAIVAQGSEAGGHRGSFLKPKNQLPMVGTISLVPQIVDVV---SIPVIAAGGIMDGRGVLASIVLGAEGVQMGT 240          
BLAST of FC920194 vs. ExPASy Swiss-Prot
Match: 2NPD_STAAE (Probable 2-nitropropane dioxygenase OS=Staphylococcus aureus (strain Newman) GN=NWMN_0792 PE=3 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 1.404e-17
Identity = 51/127 (40.16%), Postives = 78/127 (61.42%), Query Frame = 2
Query:  269 NIKAILSEKVAVLQVSWGEYSEELVLEAHSAGVKVVPQVGSFDEARKAVNAGVDAIIVQGREAGGH---------VIGQDGLISLLPMVVDLIGDRDIPIIAAGGIVDARGYVAALSLGAQGICLGT 622
            +I  I+ ++V V   ++G  SE+++    +A VK++    S DEA     AG+DAI+ QG EAGGH          +   G ISL+P +VD++    IP+IAAGGI+D RG +A++ LGA+G+ +GT
Sbjct:  117 HIDTIIKKQVPVCCFTFGIPSEQIISRLKAANVKLIGTATSVDEAIANEKAGMDAIVAQGSEAGGHRGSFLKPKNQLPMVGTISLVPQIVDVV---SIPVIAAGGIMDGRGVLASIVLGAEGVQMGT 240          
BLAST of FC920194 vs. ExPASy Swiss-Prot
Match: 2NPD_STAAC (Probable 2-nitropropane dioxygenase OS=Staphylococcus aureus (strain COL) GN=SACOL0922 PE=3 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 1.404e-17
Identity = 51/127 (40.16%), Postives = 78/127 (61.42%), Query Frame = 2
Query:  269 NIKAILSEKVAVLQVSWGEYSEELVLEAHSAGVKVVPQVGSFDEARKAVNAGVDAIIVQGREAGGH---------VIGQDGLISLLPMVVDLIGDRDIPIIAAGGIVDARGYVAALSLGAQGICLGT 622
            +I  I+ ++V V   ++G  SE+++    +A VK++    S DEA     AG+DAI+ QG EAGGH          +   G ISL+P +VD++    IP+IAAGGI+D RG +A++ LGA+G+ +GT
Sbjct:  117 HIDTIIKKQVPVCCFTFGIPSEQIISRLKAANVKLIGTATSVDEAIANEKAGMDAIVAQGSEAGGHRGSFLKPKNQLPMVGTISLVPQIVDVV---SIPVIAAGGIMDGRGVLASIVLGAEGVQMGT 240          
BLAST of FC920194 vs. ExPASy Swiss-Prot
Match: 2NPD_STAA8 (Probable 2-nitropropane dioxygenase OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_00855 PE=3 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 1.404e-17
Identity = 51/127 (40.16%), Postives = 78/127 (61.42%), Query Frame = 2
Query:  269 NIKAILSEKVAVLQVSWGEYSEELVLEAHSAGVKVVPQVGSFDEARKAVNAGVDAIIVQGREAGGH---------VIGQDGLISLLPMVVDLIGDRDIPIIAAGGIVDARGYVAALSLGAQGICLGT 622
            +I  I+ ++V V   ++G  SE+++    +A VK++    S DEA     AG+DAI+ QG EAGGH          +   G ISL+P +VD++    IP+IAAGGI+D RG +A++ LGA+G+ +GT
Sbjct:  117 HIDTIIKKQVPVCCFTFGIPSEQIISRLKAANVKLIGTATSVDEAIANEKAGMDAIVAQGSEAGGHRGSFLKPKNQLPMVGTISLVPQIVDVV---SIPVIAAGGIMDGRGVLASIVLGAEGVQMGT 240          
BLAST of FC920194 vs. ExPASy Swiss-Prot
Match: 2NPD_STAA3 (Probable 2-nitropropane dioxygenase OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_0825 PE=3 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 1.404e-17
Identity = 51/127 (40.16%), Postives = 78/127 (61.42%), Query Frame = 2
Query:  269 NIKAILSEKVAVLQVSWGEYSEELVLEAHSAGVKVVPQVGSFDEARKAVNAGVDAIIVQGREAGGH---------VIGQDGLISLLPMVVDLIGDRDIPIIAAGGIVDARGYVAALSLGAQGICLGT 622
            +I  I+ ++V V   ++G  SE+++    +A VK++    S DEA     AG+DAI+ QG EAGGH          +   G ISL+P +VD++    IP+IAAGGI+D RG +A++ LGA+G+ +GT
Sbjct:  117 HIDTIIKKQVPVCCFTFGIPSEQIISRLKAANVKLIGTATSVDEAIANEKAGMDAIVAQGSEAGGHRGSFLKPKNQLPMVGTISLVPQIVDVV---SIPVIAAGGIMDGRGVLASIVLGAEGVQMGT 240          
BLAST of FC920194 vs. ExPASy Swiss-Prot
Match: 2NPD_NEUCR (2-nitropropane dioxygenase OS=Neurospora crassa GN=ncd-2 PE=1 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 2.395e-17
Identity = 58/171 (33.92%), Postives = 90/171 (52.63%), Query Frame = 2
Query:  200 RKTRSLTERPF----GVGVVLAFPHNENIKAILSEKVAVL-----QVSW---------------GEYSEELVLEA-HSAGVKVVPQVGSFDEARKAVNAGVDAIIVQGREAGGHVIGQ-DGLISLLPMVVDLIG----DRDIPIIAAGGIVDARGYVAALSLGAQGICLGT 622
            R    LT+RP     G+GV L   H  ++  +    + +L     Q  W                + + + ++EA H++G  V  QVG+  +ARKA   G D I+ QG +AGGH +    G++SL+P V D++     +R++ ++AAGG+ D RG V AL LGA+G+ LGT
Sbjct:   83 RSRLGLTDRPLTPLPGIGVGLILTHTISVPYVTDTVLPILIEHSPQAVWLFANDPDFEASSEPGAKGTAKQIIEALHASGFVVFFQVGTVKDARKAAADGADVIVAQGIDAGGHQLATGSGIVSLVPEVRDMLDREFKEREVVVVAAGGVADGRGVVGALGLGAEGVVLGT 253          
BLAST of FC920194 vs. ExPASy Swiss-Prot
Match: 2NPD_STAAS (Probable 2-nitropropane dioxygenase OS=Staphylococcus aureus (strain MSSA476) GN=SAS0791 PE=3 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 4.084e-17
Identity = 50/127 (39.37%), Postives = 76/127 (59.84%), Query Frame = 2
Query:  269 NIKAILSEKVAVLQVSWGEYSEELVLEAHSAGVKVVPQVGSFDEARKAVNAGVDAIIVQGREAGGH---------VIGQDGLISLLPMVVDLIGDRDIPIIAAGGIVDARGYVAALSLGAQGICLGT 622
            +I  I+ ++V V   ++G  SE ++     A +K++    S DEA     AG+DAI+ QG EAGGH          +   G ISL+P +VD++    IP+IAAGGI+D RG +A++ LGA+G+ +GT
Sbjct:  117 HIDTIIKKQVPVCCFTFGIPSESIIKRLKEANIKLIGTATSVDEAIANEKAGMDAIVAQGSEAGGHRGSFLKPKNQLPMVGTISLVPQIVDVV---SIPVIAAGGIMDGRGVLASIVLGAEGVQMGT 240          
BLAST of FC920194 vs. ExPASy Swiss-Prot
Match: 2NPD_STAAR (Probable 2-nitropropane dioxygenase OS=Staphylococcus aureus (strain MRSA252) GN=SAR0883 PE=3 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 9.099e-17
Identity = 49/127 (38.58%), Postives = 76/127 (59.84%), Query Frame = 2
Query:  269 NIKAILSEKVAVLQVSWGEYSEELVLEAHSAGVKVVPQVGSFDEARKAVNAGVDAIIVQGREAGGH---------VIGQDGLISLLPMVVDLIGDRDIPIIAAGGIVDARGYVAALSLGAQGICLGT 622
            +I  I+ ++V V   ++G  +E ++     A +K++    S DEA     AG+DAI+ QG EAGGH          +   G ISL+P +VD++    IP+IAAGGI+D RG +A++ LGA+G+ +GT
Sbjct:  117 HIDTIIKKQVPVCCFTFGIPNESIIKRLKEANIKLIGTATSVDEAIANEKAGMDAIVAQGSEAGGHRGSFLKPKNQLPMVGTISLVPQIVDVV---SIPVIAAGGIMDGRGVLASIVLGAEGVQMGT 240          
BLAST of FC920194 vs. ExPASy Swiss-Prot
Match: 2NPD_STAAN (Probable 2-nitropropane dioxygenase OS=Staphylococcus aureus (strain N315) GN=SA0781 PE=3 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.188e-16
Identity = 49/127 (38.58%), Postives = 76/127 (59.84%), Query Frame = 2
Query:  269 NIKAILSEKVAVLQVSWGEYSEELVLEAHSAGVKVVPQVGSFDEARKAVNAGVDAIIVQGREAGGH---------VIGQDGLISLLPMVVDLIGDRDIPIIAAGGIVDARGYVAALSLGAQGICLGT 622
            +I  I+ ++V V   ++G  +E ++     A +K++    S DEA     AG+DAI+ QG EAGGH          +   G ISL+P +VD++    IP+IAAGGI+D RG +A++ LGA+G+ +GT
Sbjct:  117 HIDTIIKKQVPVCCFTFGIPNESIIERLKEANIKLIGTATSVDEAIANEKAGMDAIVAQGSEAGGHRGSFLKPKNQLPMVGTISLVPQIVDVV---SIPVIAAGGIMDGRGVLASIVLGAEGVQMGT 240          
BLAST of FC920194 vs. ExPASy Swiss-Prot
Match: 2NPD_STAA9 (Probable 2-nitropropane dioxygenase OS=Staphylococcus aureus (strain JH9) GN=SaurJH9_0919 PE=3 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.188e-16
Identity = 49/127 (38.58%), Postives = 76/127 (59.84%), Query Frame = 2
Query:  269 NIKAILSEKVAVLQVSWGEYSEELVLEAHSAGVKVVPQVGSFDEARKAVNAGVDAIIVQGREAGGH---------VIGQDGLISLLPMVVDLIGDRDIPIIAAGGIVDARGYVAALSLGAQGICLGT 622
            +I  I+ ++V V   ++G  +E ++     A +K++    S DEA     AG+DAI+ QG EAGGH          +   G ISL+P +VD++    IP+IAAGGI+D RG +A++ LGA+G+ +GT
Sbjct:  117 HIDTIIKKQVPVCCFTFGIPNESIIERLKEANIKLIGTATSVDEAIANEKAGMDAIVAQGSEAGGHRGSFLKPKNQLPMVGTISLVPQIVDVV---SIPVIAAGGIMDGRGVLASIVLGAEGVQMGT 240          
The following BLAST results are available for this feature:
BLAST of FC920194 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 15
Match NameE-valueIdentityDescription
2NPD_STAAT1.404e-1740.16Probable 2-nitropropane dioxygenase OS=Staphylococ... [more]
2NPD_STAAE1.404e-1740.16Probable 2-nitropropane dioxygenase OS=Staphylococ... [more]
2NPD_STAAC1.404e-1740.16Probable 2-nitropropane dioxygenase OS=Staphylococ... [more]
2NPD_STAA81.404e-1740.16Probable 2-nitropropane dioxygenase OS=Staphylococ... [more]
2NPD_STAA31.404e-1740.16Probable 2-nitropropane dioxygenase OS=Staphylococ... [more]
2NPD_NEUCR2.395e-1733.922-nitropropane dioxygenase OS=Neurospora crassa GN... [more]
2NPD_STAAS4.084e-1739.37Probable 2-nitropropane dioxygenase OS=Staphylococ... [more]
2NPD_STAAR9.099e-1738.58Probable 2-nitropropane dioxygenase OS=Staphylococ... [more]
2NPD_STAAN1.188e-1638.58Probable 2-nitropropane dioxygenase OS=Staphylococ... [more]
2NPD_STAA91.188e-1638.58Probable 2-nitropropane dioxygenase OS=Staphylococ... [more]

Pages

back to top
Libraries
Library NameType
RVDevelop1cdna_library
Properties
Property NameValue
Genbank descriptionC32005C02EF RVDevelop1 Citrus clementina cDNA clone C32005C02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920194 ID=FC920194|Name=FC920194|organism=Citrus clementina|type=EST|length=660bp
GACAGATCATTTGTATACTTTGATCTTTACTCTAATGGGTTGGAGAGGAA
TGCTGGGTTTCGAGTATGGGATTGTTCAGGCACCATTGGGACCTGATATT
TCAGGCCCGGAGCTTGTAGCTGCTGTTGCTAATGCCGGTGGTCTTGGTCT
TCTTAGAGCCCCCGATTGGGAAGCACCAGATTACTTGAGGGATCTGATAA
GGAAGACAAGATCATTAACAGAGCGACCATTTGGGGTTGGTGTGGTTCTA
GCATTTCCCCACAACGAAAATATAAAGGCTATACTTAGTGAAAAAGTAGC
AGTTTTGCAAGTTTCCTGGGGTGAATATTCAGAGGAGCTCGTTCTTGAAG
CTCATAGTGCTGGAGTCAAAGTTGTCCCCCAAGTTGGGAGTTTTGACGAA
GCAAGAAAAGCAGTTAACGCAGGTGTAGATGCAATTATAGTCCAAGGACG
TGAAGCTGGGGGCCATGTAATTGGACAGGATGGTTTGATTTCCTTATTGC
CAATGGTGGTTGATCTTATCGGGGATCGAGATATTCCAATAATTGCTGCA
GGTGGTATTGTGGATGCACGTGGTTATGTTGCAGCCCTGTCTCTTGGTGC
TCAAGGCATCTGCTTAGGCACAGGTTTGTGGCAAGTGAGGAAAGCTATGC
GCATCCTGAG
back to top