FC920388

Overview
NameFC920388
Unique NameFC920388
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length691
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig6173 contig Ccv1_Contig6173:29..719. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920388 vs. ExPASy Swiss-Prot
Match: ALF_MAIZE (Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Zea mays PE=2 SV=1)

HSP 1 Score: 362.844 bits (930), Expect = 9.483e-100
Identity = 182/208 (87.50%), Postives = 190/208 (91.35%), Query Frame = 2
Query:   68 MSCFKGKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVEANRRALRELLFCTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPIVEPEILVDGPHDIKQCADVTERVLAAC 691
            MS + GKY DELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVE NRRALRELLFC PGALQY+SGVILFEETLYQKT  GKPFVDVLKEGGVLPGIKVDKGT+E+ GT+ ETTTQG D L +RC KYYEAGARFAKWRAVLKIGPNEPSQLAI+ NA GLARYAIICQENGLVPIVEPEILVDGPHDI +CA VTE VLAAC
Sbjct:    1 MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVEENRRALRELLFCCPGALQYISGVILFEETLYQKTKDGKPFVDVLKEGGVLPGIKVDKGTIEVVGTDKETTTQGHDDLGKRCAKYYEAGARFAKWRAVLKIGPNEPSQLAIDLNAQGLARYAIICQENGLVPIVEPEILVDGPHDIDRCAYVTETVLAAC 208          
BLAST of FC920388 vs. ExPASy Swiss-Prot
Match: ALF_ORYSJ (Fructose-bisphosphate aldolase cytoplasmic isozyme OS=Oryza sativa subsp. japonica GN=FBA PE=1 SV=2)

HSP 1 Score: 360.918 bits (925), Expect = 3.604e-99
Identity = 181/208 (87.02%), Postives = 190/208 (91.35%), Query Frame = 2
Query:   68 MSCFKGKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVEANRRALRELLFCTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPIVEPEILVDGPHDIKQCADVTERVLAAC 691
            MS + GKY DELIKNAAYIGTPGKGILAADESTGTIGKR +SINVENVE NRR+LRELLFCTPGALQYLSGVILFEETLYQKT  GKPFVDVLKEGGVLPGIKVDKGT+E+AGT  ETTTQG D L +RC KYYEAGARFAKWRAVLKIGPNEPSQLAI+ NA GLARYAIICQENGLVPIVEPEILVDGPHDI +CA V+E VLAAC
Sbjct:    1 MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIGKRFASINVENVEENRRSLRELLFCTPGALQYLSGVILFEETLYQKTKDGKPFVDVLKEGGVLPGIKVDKGTIEVAGTEKETTTQGHDDLGKRCAKYYEAGARFAKWRAVLKIGPNEPSQLAIDLNAQGLARYAIICQENGLVPIVEPEILVDGPHDIDRCAYVSEVVLAAC 208          
BLAST of FC920388 vs. ExPASy Swiss-Prot
Match: ALF_SPIOL (Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Spinacia oleracea PE=2 SV=1)

HSP 1 Score: 358.992 bits (920), Expect = 1.369e-98
Identity = 179/208 (86.06%), Postives = 190/208 (91.35%), Query Frame = 2
Query:   68 MSCFKGKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVEANRRALRELLFCTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPIVEPEILVDGPHDIKQCADVTERVLAAC 691
            M+ ++GKYADELI NA+YI TPGK ILAADESTGTIGKR  SINVENVE+NRRALRELLF TPGAL YLSGVILFEETLYQKTA GKPFVD +K+GGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRC +YY AGARFAKWRAVLKIGP EPS LAI ENANGLARY IICQENGLVPIVEPEILVDG HDI +CA+V+ERVLAAC
Sbjct:    1 MTAYRGKYADELIANASYIATPGKVILAADESTGTIGKRFPSINVENVESNRRALRELLFTTPGALPYLSGVILFEETLYQKTADGKPFVDAMKDGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCAQYYTAGARFAKWRAVLKIGPTEPSPLAILENANGLARYGIICQENGLVPIVEPEILVDGTHDIDRCAEVSERVLAAC 208          
BLAST of FC920388 vs. ExPASy Swiss-Prot
Match: ALF2_PEA (Fructose-bisphosphate aldolase, cytoplasmic isozyme 2 OS=Pisum sativum PE=3 SV=1)

HSP 1 Score: 345.51 bits (885), Expect = 1.567e-94
Identity = 178/208 (85.58%), Postives = 188/208 (90.38%), Query Frame = 2
Query:   68 MSCFKGKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVEANRRALRELLFCTPGA-LQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPIVEPEILVDGPHDIKQCADVTERVLAA 688
            MS FK KY DELI NAAYIGTPGKGILAADESTGTIGKRLSSINVENVE+NR+ALRELLF      LQYLSGVILFEETLYQKTAAGKPFVDVL E GVLPGIKVDKGTVELAGT+GETTTQGLDGL  RC+KYYEAGARFAKWRAVLKIG NEPS+ +I+ENA GLARYA+ICQENGLVPIVEPEILVDG HDI +CA +TERVLAA
Sbjct:    1 MSHFKSKYHDELIANAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRQALRELLFTASWLFLQYLSGVILFEETLYQKTAAGKPFVDVLNEAGVLPGIKVDKGTVELAGTDGETTTQGLDGLGARCRKYYEAGARFAKWRAVLKIGANEPSEHSIHENAYGLARYAVICQENGLVPIVEPEILVDGSHDILKCAAITERVLAA 208          
BLAST of FC920388 vs. ExPASy Swiss-Prot
Match: ALF_CICAR (Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Cicer arietinum GN=ALDC PE=2 SV=1)

HSP 1 Score: 343.969 bits (881), Expect = 4.558e-94
Identity = 177/208 (85.10%), Postives = 184/208 (88.46%), Query Frame = 2
Query:   68 MSCFKGKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVEANRRALRELLFCTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAIN-ENANGLARYAIICQENGLVPIVEPEILVDGPHDIKQCADVTERVLAA 688
            MS FK KY DELI NAAYIGTPGKGILAADESTGTIGKRL+SINVENVE NRRALRELLF  P  LQYLSGVILFEETLYQ TAAGKPFVDVL E GVLPGIKVDKGTVELAGT+GETTTQGLDGL  RC KYYEAGARFAKWRAVLKIGPNEPS   ++ ENA GLARYA+ICQENGLVPIVE EILVDG HDI +CA +TERVLAA
Sbjct:    1 MSNFKSKYHDELIANAAYIGTPGKGILAADESTGTIGKRLASINVENVETNRRALRELLFTAPNVLQYLSGVILFEETLYQSTAAGKPFVDVLNEAGVLPGIKVDKGTVELAGTDGETTTQGLDGLGARCAKYYEAGARFAKWRAVLKIGPNEPSLSILSIENAYGLARYAVICQENGLVPIVELEILVDGSHDIHKCAAITERVLAA 208          
BLAST of FC920388 vs. ExPASy Swiss-Prot
Match: ALF1_PEA (Fructose-bisphosphate aldolase, cytoplasmic isozyme 1 OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 340.887 bits (873), Expect = 3.859e-93
Identity = 168/208 (80.77%), Postives = 185/208 (88.94%), Query Frame = 2
Query:   68 MSCFKGKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVEANRRALRELLFCTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPIVEPEILVDGPHDIKQCADVTERVLAAC 691
            MS F GKYADELIKNA YI TPGKGILAADESTGTIGKRL+SINVEN+EANR+ALRELLF +P ALQYLSGVILFEETLYQK++ GKPFV++L+E  V+PGIKVDKG VELAGT+GETTTQG D L  RCQ+YY+AGARFAKWRAVLKIGPNEPS+L+I +NA GLARYAIICQENGLV  VEPEIL DG HDI +CA VTE VLAAC
Sbjct:    1 MSAFVGKYADELIKNAKYIATPGKGILAADESTGTIGKRLASINVENIEANRQALRELLFTSPNALQYLSGVILFEETLYQKSSEGKPFVEILQENNVIPGIKVDKGVVELAGTDGETTTQGFDSLGARCQQYYKAGARFAKWRAVLKIGPNEPSELSIQQNAQGLARYAIICQENGLVLFVEPEILTDGSHDIAKCAAVTETVLAAC 208          
BLAST of FC920388 vs. ExPASy Swiss-Prot
Match: ALF_ARATH (Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Arabidopsis thaliana GN=At4g26520 PE=2 SV=2)

HSP 1 Score: 309.686 bits (792), Expect = 9.527e-84
Identity = 156/207 (75.36%), Postives = 171/207 (82.61%), Query Frame = 2
Query:   68 MSCFKGKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVEANRRALRELLFCTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPIVEPEILVDGPHDIKQCADVTERVLAA 688
            MS F  KY DELIK A YI TPG+GILAADEST TIGKR + INVEN E+NR+A RELLF +PG+   LSGVILFEETLYQKT+ GKPFVD+L E GV+PGIKVDKG V+LAGTNGETTTQGLD L  RCQ+YYEAGARFAKWRA  KIG  EPS L+I E+A  LARYAIICQENGLVPIVEPE+L  G HDIK+CA VTE VLAA
Sbjct:    1 MSAFVSKYEDELIKTAKYIATPGRGILAADESTETIGKRFAGINVENTESNRQAYRELLFTSPGSYPCLSGVILFEETLYQKTSDGKPFVDLLMENGVIPGIKVDKGLVDLAGTNGETTTQGLDSLGARCQQYYEAGARFAKWRAFFKIGATEPSVLSIQEDARVLARYAIICQENGLVPIVEPEVLTGGSHDIKKCAAVTETVLAA 207          
BLAST of FC920388 vs. ExPASy Swiss-Prot
Match: ALF_DICDI (Fructose-bisphosphate aldolase OS=Dictyostelium discoideum GN=fba PE=3 SV=1)

HSP 1 Score: 262.307 bits (669), Expect = 1.744e-69
Identity = 139/204 (68.14%), Postives = 161/204 (78.92%), Query Frame = 2
Query:   86 KYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVEANRRALRELLFCTP-GALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKI--GPNEPSQLAINENANGLARYAIICQENGLVPIVEPEILVDGPHDIKQCADVTERVLAA 688
            K+ADELI  A  I  PGKGILAADEST TIG R   IN+EN E NRRA RELL  T  G  +++ G+IL+EETLYQK A G+ F DVL+E  +  GIKVDKG V + GT+GET+TQGLDGLA+RC+KYYEAGARFAKWRAVLKI    N PSQL+I ENA+ LARYA ICQENGLVPIVEPEIL+DG H ++Q A+VTE+VLAA
Sbjct:    4 KFADELIATAKAIVAPGKGILAADESTNTIGARFKKINLENNEENRRAYRELLIGTGNGVNEFIGGIILYEETLYQKMADGRLFTDVLREQKIHIGIKVDKGVVPIPGTDGETSTQGLDGLAERCKKYYEAGARFAKWRAVLKIDLAKNCPSQLSITENAHTLARYAAICQENGLVPIVEPEILMDGNHTVEQSAEVTEKVLAA 207          
BLAST of FC920388 vs. ExPASy Swiss-Prot
Match: ALF2_LAMJA (Fructose-bisphosphate aldolase, non-muscle type OS=Lampetra japonica PE=2 SV=1)

HSP 1 Score: 255.373 bits (651), Expect = 2.132e-67
Identity = 133/198 (67.17%), Postives = 156/198 (78.79%), Query Frame = 2
Query:   98 ELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVEANRRALRELLFCT-PGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPIVEPEILVDGPHDIKQCADVTERVLAA 688
            EL + A  I + GKGILAADESTGT+GKRLS+I VENV+ NRR  R+LLF + P   + + GVI +EETLYQKT  G PFV ++K+ G++ GIKVDKGTV LAGT+GE+TTQGLDGLA+RC +Y + GA FAKWR VLKI  N PS LAI ENAN LARYA ICQ+NGLVPIVEPEIL DG HD+K C  VTE+VLAA
Sbjct:   15 ELAEIAQRIVSNGKGILAADESTGTMGKRLSAIKVENVDENRRVYRQLLFSSDPSVTKAIGGVIFYEETLYQKTDDGTPFVKLIKDRGIVVGIKVDKGTVPLAGTDGESTTQGLDGLAERCARYKKDGADFAKWRCVLKISKNTPSALAIAENANVLARYASICQQNGLVPIVEPEILPDGDHDLKTCQYVTEKVLAA 212          
BLAST of FC920388 vs. ExPASy Swiss-Prot
Match: ALF_ECHMU (Fructose-bisphosphate aldolase OS=Echinococcus multilocularis GN=FBPA PE=2 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 3.637e-67
Identity = 131/197 (66.50%), Postives = 153/197 (77.66%), Query Frame = 2
Query:   98 ELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVEANRRALRELLFCT-PGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPIVEPEILVDGPHDIKQCADVTERVLA 685
            EL +NA+ I  PGKG+LAADEST TIGKR ++IN+EN E NRRA RELLF T P   +++SGVILF ET+YQKT  GKPFV++L+E GVLPGIKVD G V L GT  E TTQGLD LAQRC +YY  G RFAKWR VLKI  + PS LA+ ENAN LARYA ICQ+NGLVPIVEPE+L DG HD++    VTE+VL+
Sbjct:   15 ELRENASAIVAPGKGLLAADESTNTIGKRFAAINLENTEENRRAYRELLFTTDPEFAKHISGVILFHETVYQKTKDGKPFVELLRERGVLPGIKVDLGVVPLGGTADECTTQGLDNLAQRCAQYYNDGCRFAKWRCVLKISSHNPSYLAMLENANVLARYAFICQQNGLVPIVEPEVLPDGDHDLETAQRVTEQVLS 211          
The following BLAST results are available for this feature:
BLAST of FC920388 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 56
Match NameE-valueIdentityDescription
ALF_MAIZE9.483e-10087.50Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF_ORYSJ3.604e-9987.02Fructose-bisphosphate aldolase cytoplasmic isozyme... [more]
ALF_SPIOL1.369e-9886.06Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF2_PEA1.567e-9485.58Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF_CICAR4.558e-9485.10Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF1_PEA3.859e-9380.77Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF_ARATH9.527e-8475.36Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF_DICDI1.744e-6968.14Fructose-bisphosphate aldolase OS=Dictyostelium di... [more]
ALF2_LAMJA2.132e-6767.17Fructose-bisphosphate aldolase, non-muscle type OS... [more]
ALF_ECHMU3.637e-6766.50Fructose-bisphosphate aldolase OS=Echinococcus mul... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32007F10EF RVDevelop1 Citrus clementina cDNA clone C32007F10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920388 ID=FC920388|Name=FC920388|organism=Citrus clementina|type=EST|length=691bp
GGCATAAAATCGCTCTCTCTGTTTCTCCCTCTAACAAAACAAATTTTCTA
TCTTCAAGTAGATCACCATGTCTTGCTTCAAGGGCAAATACGCCGATGAG
CTCATTAAAAACGCTGCCTACATTGGCACCCCTGGAAAGGGTATCCTTGC
TGCTGATGAGTCAACAGGCACCATTGGCAAGCGTCTATCCAGCATCAATG
TTGAGAATGTTGAGGCAAACAGGCGTGCTCTCCGCGAGCTCCTTTTCTGC
ACTCCCGGTGCCCTTCAGTACCTCAGTGGTGTCATCCTCTTCGAGGAGAC
CCTCTACCAGAAGACTGCTGCTGGCAAGCCCTTTGTTGATGTCTTGAAGG
AGGGTGGAGTCCTCCCTGGAATTAAGGTTGACAAGGGTACTGTTGAGCTT
GCTGGTACCAATGGTGAGACCACCACCCAGGGTCTTGATGGCCTCGCCCA
GCGCTGCCAGAAATACTATGAAGCTGGTGCTCGTTTTGCCAAATGGCGTG
CTGTTCTTAAGATTGGCCCTAATGAGCCTTCGCAGCTGGCCATCAATGAG
AATGCCAATGGCCTGGCCCGATATGCTATCATCTGCCAGGAGAATGGCCT
TGTTCCCATTGTTGAACCTGAGATCCTTGTTGACGGTCCCCATGACATCA
AACAGTGTGCTGATGTGACCGAGCGTGTTCTTGCTGCATGC
back to top