FC924881

Overview
NameFC924881
Unique NameFC924881
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length254
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig1789 contig Ccv1_Contig1789:1..254. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC924881 vs. ExPASy Swiss-Prot
Match: PCKA1_UROPA (Phosphoenolpyruvate carboxykinase [ATP] 1 OS=Urochloa panicoides GN=PCK1 PE=1 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 2.451e-14
Identity = 36/44 (81.82%), Postives = 39/44 (88.64%), Query Frame = 2
Query:    2 KQAYKETLLKLAGLFKRNFEIFTNYKIGKDNKLTEEILAAGPNF 133
            K AYKETLLKLAGLFK NFE+F +YKIG DN LTE+ILAAGPNF
Sbjct:  581 KAAYKETLLKLAGLFKNNFEVFASYKIGDDNSLTEQILAAGPNF 624          
BLAST of FC924881 vs. ExPASy Swiss-Prot
Match: PCKA2_UROPA (Phosphoenolpyruvate carboxykinase [ATP] 2 OS=Urochloa panicoides GN=PCK2 PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 3.540e-13
Identity = 34/44 (77.27%), Postives = 38/44 (86.36%), Query Frame = 2
Query:    2 KQAYKETLLKLAGLFKRNFEIFTNYKIGKDNKLTEEILAAGPNF 133
            K AYKETLLKLAGLFK NFE+F +YKIG +N LTE+ILAA PNF
Sbjct:  583 KAAYKETLLKLAGLFKNNFEVFASYKIGNNNSLTEQILAAAPNF 626          
BLAST of FC924881 vs. ExPASy Swiss-Prot
Match: PCKA_MAIZE (Phosphoenolpyruvate carboxykinase [ATP] OS=Zea mays PE=2 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 2.294e-12
Identity = 32/44 (72.73%), Postives = 37/44 (84.09%), Query Frame = 2
Query:    2 KQAYKETLLKLAGLFKRNFEIFTNYKIGKDNKLTEEILAAGPNF 133
            K AYKE LL+L GLFK NFE+F +YKIG D+ LT+EILAAGPNF
Sbjct:  623 KAAYKENLLRLGGLFKNNFEVFASYKIGDDSSLTDEILAAGPNF 666          
BLAST of FC924881 vs. ExPASy Swiss-Prot
Match: PCKA_ARATH (Phosphoenolpyruvate carboxykinase [ATP] OS=Arabidopsis thaliana GN=PCKA PE=1 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 3.914e-12
Identity = 32/44 (72.73%), Postives = 39/44 (88.64%), Query Frame = 2
Query:    2 KQAYKETLLKLAGLFKRNFEIFTNYKIGKDNKLTEEILAAGPNF 133
            K+A+K+TL+KL GLFK+NFE+F N+KIG D KLTEEILAAGP F
Sbjct:  628 KKAHKDTLVKLGGLFKKNFEVFANHKIGVDGKLTEEILAAGPIF 671          
The following BLAST results are available for this feature:
BLAST of FC924881 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
PCKA1_UROPA2.451e-1481.82Phosphoenolpyruvate carboxykinase [ATP] 1 OS=Uroch... [more]
PCKA2_UROPA3.540e-1377.27Phosphoenolpyruvate carboxykinase [ATP] 2 OS=Uroch... [more]
PCKA_MAIZE2.294e-1272.73Phosphoenolpyruvate carboxykinase [ATP] OS=Zea may... [more]
PCKA_ARATH3.914e-1272.73Phosphoenolpyruvate carboxykinase [ATP] OS=Arabido... [more]
back to top
Libraries
Library NameType
TFcdna_library
Properties
Property NameValue
Genbank descriptionKN0AAP1YL01FM1 TF Citrus clementina cDNA clone KN0AAP1YL01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC924881 ID=FC924881|Name=FC924881|organism=Citrus clementina|type=EST|length=254bp
CAAGCAGGCTTACAAGGAGACACTGCTGAAGCTGGCTGGTCTTTTCAAGA
GGAACTTTGAAATATTCACAAACTACAAGATTGGCAAGGACAACAAGCTC
ACTGAAGAGATCCTTGCAGCTGGTCCAAATTTCTAATTTAGACCGAGTGA
AGAACAAGCAAAGAACGTGAGTGTGGTTTGGGAAATATGATGGAAATAAA
GCGTAATATAGTCATATTCGACATGTGTGGTTCGATTCATATGTAAACTT
GTTC
back to top