FC924894

Overview
NameFC924894
Unique NameFC924894
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length725
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig1792 contig Ccv1_Contig1792:2..726. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC924894 vs. ExPASy Swiss-Prot
Match: SLU7_ORYSJ (Pre-mRNA-splicing factor SLU7 OS=Oryza sativa subsp. japonica GN=Os08g0127700 PE=2 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 9.445e-37
Identity = 105/262 (40.08%), Postives = 132/262 (50.38%), Query Frame = 3
Query:   99 MAPASVGSKSTVDWEEINTHVPLYMKHAPWYAKSEVPDNLKHQRKQKESLQSNINLCYDRGAKTFQAD*YRKGACENCEAMSHNANSIMERPRKRRAILTNM-------------------------------RIAAD----EKIEKIVMIQQSMPVMSVRD------------------MKLITKMV*SLMRVTLRILPQVKKGVCGNGSGITGTNRDLRIREDIPKYLLNLDENSAYYDPKIRSMREDLNPDDNPNEKFY 725
            +APA V      D +EIN H+P YM  APWY  ++ P +LKHQR  K    +     YDRGAK FQA+ YRKGACENC AM+H+  S MERPR   A  TN+                               R+ AD    E+  K  + +Q +  +  +D                  +K+    V    ++      +V+K V   G G TGT R+LRIRED  KYLLNLD NSAYYDPK RSMRED  PD +PN+KFY
Sbjct:   28 LAPAEVDE----DGKEINPHIPQYMSSAPWYLNADKP-SLKHQRNWKSD-PNYTKSWYDRGAKLFQANKYRKGACENCGAMTHDKKSCMERPRSVGAKWTNINIAPDEKVESFELDYDGKRDRWNGYDPSTYTRVIADYEAREEARKKYLKEQQLKKLEEKDGEEGDENVASEEEDEEDGLKIDEAKVDESAQMDFA---KVEKRVRTTGGGSTGTVRNLRIREDTAKYLLNLDVNSAYYDPKTRSMREDPLPDADPNDKFY 280          
BLAST of FC924894 vs. ExPASy Swiss-Prot
Match: SLU7_ORYSI (Pre-mRNA-splicing factor SLU7 OS=Oryza sativa subsp. indica GN=OsI_27673 PE=3 SV=2)

HSP 1 Score: 153.68 bits (387), Expect = 9.445e-37
Identity = 105/262 (40.08%), Postives = 132/262 (50.38%), Query Frame = 3
Query:   99 MAPASVGSKSTVDWEEINTHVPLYMKHAPWYAKSEVPDNLKHQRKQKESLQSNINLCYDRGAKTFQAD*YRKGACENCEAMSHNANSIMERPRKRRAILTNM-------------------------------RIAAD----EKIEKIVMIQQSMPVMSVRD------------------MKLITKMV*SLMRVTLRILPQVKKGVCGNGSGITGTNRDLRIREDIPKYLLNLDENSAYYDPKIRSMREDLNPDDNPNEKFY 725
            +APA V      D +EIN H+P YM  APWY  ++ P +LKHQR  K    +     YDRGAK FQA+ YRKGACENC AM+H+  S MERPR   A  TN+                               R+ AD    E+  K  + +Q +  +  +D                  +K+    V    ++      +V+K V   G G TGT R+LRIRED  KYLLNLD NSAYYDPK RSMRED  PD +PN+KFY
Sbjct:   28 LAPAEVDE----DGKEINPHIPQYMSSAPWYLNADKP-SLKHQRNWKSD-PNYTKSWYDRGAKLFQANKYRKGACENCGAMTHDKKSCMERPRSVGAKWTNINIAPDEKVESFELDYDGKRDRWNGYDPSTYTRVIADYEAREEARKKYLKEQQLKKLEEKDGEEGDENVASEEEDEEDGLKIDEAKVDESAQMDFA---KVEKRVRTTGGGSTGTVRNLRIREDTAKYLLNLDVNSAYYDPKTRSMREDPLPDADPNDKFY 280          
BLAST of FC924894 vs. ExPASy Swiss-Prot
Match: SLU7_CHICK (Pre-mRNA-splicing factor SLU7 OS=Gallus gallus GN=SLU7 PE=2 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 9.796e-26
Identity = 93/253 (36.76%), Postives = 118/253 (46.64%), Query Frame = 3
Query:  102 APASVGSKSTVDWEEINTHVPLYMKHAPWYAKSEVPDNLKHQRKQ--KESLQSNINLCYDRGAKTFQ-AD*YRKGACENCEAMSHNANSIMERPRKRRAILTNMRIAADEKIEKIVMIQQSMPVMSVRD----------MKLITKMV-*SLMRVTLRI-----------LPQVKK---------GVCGNGSGITGTN---------RDLRIREDIPKYLLNLDENSAYYDPKIRSMRED--LNPDDNPNEKFY 725
            APA V  +     ++IN H+P Y+   PWY        LKHQR Q  K+   S+    Y RG K    A  YRKGACENC A++H     MERPRK  A  T M IA DE ++  +M          RD          MK++ +     L + TL+            L QV++             +   + G N         R+LRIREDI KYL NLD NSAYYDPK R+MRE+   N   NP+E  Y
Sbjct:   46 APAEVDEEG----KDINPHIPQYISSVPWYIDPSKRPTLKHQRPQPEKQKQYSSSGDWYKRGVKEHSIATRYRKGACENCGALTHKKKDCMERPRKVGAKYTGMNIAPDEHVQPQLMFDYD----GKRDRWNGYNPEEHMKIVEEYAKVDLAKRTLKAQKLQEELASGKLEQVERDHNSEDEDEDKYADDIDMPGQNFDSKRRITVRNLRIREDIAKYLRNLDPNSAYYDPKTRAMRENPYANTGKNPDEVGY 290          
BLAST of FC924894 vs. ExPASy Swiss-Prot
Match: SLU7A_ARATH (Pre-mRNA-splicing factor SLU7-A OS=Arabidopsis thaliana GN=At1g65660 PE=1 SV=2)

HSP 1 Score: 115.546 bits (288), Expect = 2.850e-25
Identity = 63/111 (56.76%), Postives = 73/111 (65.77%), Query Frame = 3
Query:   99 MAPASVGSKSTVDWEEINTHVPLYMKHAPWYAKSEVPDNLKHQRKQKESLQSNINLCYDRGAKTFQAD*YRKGACENCEAMSHNANSIMERPRKRRAILTNMRIAADEKIE 431
            +APA V      D +EIN H+P YM  APWY  SE P +LKHQRK K    +     YDRGAK FQA+ YRKGAC+NC AM+H A + M+RPRK  A  TNM IA DEKIE
Sbjct:   28 LAPAEVDE----DGKEINPHIPQYMSSAPWYLNSEKP-SLKHQRKWKSD-PNYTKSWYDRGAKIFQAEKYRKGACQNCGAMTHTAKACMDRPRKIGAKYTNMNIAPDEKIE 132          

HSP 2 Score: 84.3445 bits (207), Expect = 7.037e-16
Identity = 42/62 (67.74%), Postives = 48/62 (77.42%), Query Frame = 3
Query:  540 QVKKGVCGNGSGITGTNRDLRIREDIPKYLLNLDENSAYYDPKIRSMREDLNPDDNPNEKFY 725
            +V+K V   G G TGT R+LRIRED  KYLLNLD NSA+YDPK RSMRED  PD +PN+KFY
Sbjct:  219 KVEKRVRTTGGGSTGTVRNLRIREDTAKYLLNLDVNSAHYDPKTRSMREDPLPDADPNDKFY 280          
BLAST of FC924894 vs. ExPASy Swiss-Prot
Match: SLU7B_ARATH (Pre-mRNA-splicing factor SLU7-B OS=Arabidopsis thaliana GN=At4g37120 PE=2 SV=3)

HSP 1 Score: 110.923 bits (276), Expect = 7.021e-24
Identity = 60/111 (54.05%), Postives = 74/111 (66.67%), Query Frame = 3
Query:   99 MAPASVGSKSTVDWEEINTHVPLYMKHAPWYAKSEVPDNLKHQRKQKESLQSNINLCYDRGAKTFQAD*YRKGACENCEAMSHNANSIMERPRKRRAILTNMRIAADEKIE 431
            +APA V      D +EIN H+P YM  APWY KSE P +LKHQ+  K   +    + YDRG K +QA+ YRKGAC NC AM+H++ + M+RPRK  A  TNM IAADEKIE
Sbjct:   28 LAPAEVDE----DGKEINPHIPEYMSKAPWYLKSEQP-SLKHQKNWKIEPEPK-KIWYDRGKKIYQAEQYRKGACINCGAMTHSSKACMDRPRKIGAKYTNMNIAADEKIE 132          

HSP 2 Score: 85.5001 bits (210), Expect = 3.159e-16
Identity = 43/62 (69.35%), Postives = 48/62 (77.42%), Query Frame = 3
Query:  540 QVKKGVCGNGSGITGTNRDLRIREDIPKYLLNLDENSAYYDPKIRSMREDLNPDDNPNEKFY 725
            +V+K V   G G TGT R+LRIRED  KYLLNLD NSA+YDPK RSMRED  PD +PNEKFY
Sbjct:  219 KVEKRVRTTGGGSTGTVRNLRIREDTAKYLLNLDVNSAHYDPKTRSMREDPLPDADPNEKFY 280          
BLAST of FC924894 vs. ExPASy Swiss-Prot
Match: SLU7_DROME (Pre-mRNA-splicing factor Slu7 OS=Drosophila melanogaster GN=Slu7 PE=1 SV=2)

HSP 1 Score: 106.301 bits (264), Expect = 1.729e-22
Identity = 78/228 (34.21%), Postives = 111/228 (48.68%), Query Frame = 3
Query:  102 APASVGSKSTVDWEEINTHVPLYMKHAPWYAKSEVPDNLKHQRKQKESLQSNINLCYDRGAKTFQA-D*YRKGACENCEAMSHNANSIMERPRKRRA------------ILTNMRIAADEKIEKIVMIQQSMPVMSVRDMKLITKMV*SLMRVTLRILPQVK-KGVCGN-----------GSGITG----TNRDLRIREDIPKYLLNLDENSAYYDPKIRSMREDLNP 698
            APA+V  +      +IN H+P Y+ +APWY  S  P  LKHQR Q E  Q  ++    +G  T +    +RKGACENC A++H     +ERPRK +A            ++    +  DEK ++      +     + + + + +    L    L+  P  +     GN           G+ +      T R+LRIRED  KYL NLD NSAYYDPK RSMR++ NP
Sbjct:   49 APAAVDEEG----RDINPHIPQYISNAPWYYGSAGP-TLKHQRPQHEDEQGQLDKRAPKGLNTARIITKFRKGACENCGAVTHKRKDCLERPRKVQAKYAESIVVHDEHLVNEAAVNYDEKRDRWSSYDPANHREIIEEYEKVEEAKRQLKAEKLKNDPDAEISDEEGNEDKYVDEVDMPGTKVDSKQRITVRNLRIREDTAKYLRNLDPNSAYYDPKTRSMRDNPNP 271          
BLAST of FC924894 vs. ExPASy Swiss-Prot
Match: SLU7_CAEEL (Pre-mRNA-splicing factor SLU7 OS=Caenorhabditis elegans GN=K07C5.6 PE=2 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 1.049e-19
Identity = 75/236 (31.78%), Postives = 104/236 (44.07%), Query Frame = 3
Query:  102 APASVGSKSTVDWEEINTHVPLYMKHAPWYAKSEVPDNLKHQR--KQKESLQSNINLCYDRGAKTFQAD*YRKGACENCEAMSHNANSIMERPRKRRAILTNMRIAAD---------------------------EKIEKIVMIQQSMPVMSVRDMKLITKMV*SLMRVTLRILPQVKKGVCGNGSGITGTNRDLRIR-----------EDIPKYLLNLDENSAYYDPKIRSMRED 689
            APA V  ++  D   IN H+P+++   PWY  SE P  LKHQR  +++E   + I+  Y +G     A  +RKGACENC AM H      +RPRK  A  TN  IA D                           + IE    ++++  V+   +MK        +   T        + +    + + G + D+  R           ED  KYL NL ENS YYDPK RSMRE+
Sbjct:   44 APAMVDVQTGRD---INPHIPMFISQNPWYVPSEGP-TLKHQRPHEEREKKMTQIHEWYQKGTTGKSATKFRKGACENCGAMGHQKRDCFDRPRKSNAKETNDNIAEDDYVQPNLTLGFDAKRDRWNGYDPSTHKQVIEDYEHLEEARKVVREHEMK-----EGEVEPATTEDGAPKDEDMYAEDADMAGVSVDMDSRTRITVRNLRIREDTAKYLYNLAENSPYYDPKSRSMREN 270          
BLAST of FC924894 vs. ExPASy Swiss-Prot
Match: SLU7_ASPFU (Pre-mRNA-splicing factor slu7 OS=Aspergillus fumigatus GN=slu7 PE=3 SV=2)

HSP 1 Score: 89.3521 bits (220), Expect = 2.187e-17
Identity = 73/229 (31.88%), Postives = 102/229 (44.54%), Query Frame = 3
Query:  105 PASVGSKSTVDWEEINTHVPLYMKHAPWYAKSE--VPDNLKHQRKQKESLQSNINLCYDRGAKTFQA-D*YRKGACENCEAMSHNANSIMERPRKRRAILTNMRIAADEKIEKIVM----IQQSMPVMSVRDMKLITKMV*SLMRVTLRILPQVKKG----------------------VCGNGSGITGTNRDLRIREDIPKYLLNLDENSAYYDPKIRSMREDLNPDD 704
            PA V SK      E N ++P ++   P+Y   E    D L+HQR QK++   +    YDRG +   A   YRKGACENC AM+H +   + RPRK  A  T   I ADE ++ + +     +         + + + +    L ++     P  + G                          G   +   R+LRIRED  KYLLNLD +SA YDPK R M +    DD
Sbjct:    5 PADVASK------ERNEYIPSFIAKKPFYIDDESTANDYLEHQRLQKQATDQS--KWYDRGKRAGPAATKYRKGACENCGAMTHKSKECLSRPRKLGAKWTGKDIQADEVVQNVELGWDAKRDRWNGYDPSEYRQVIEEYEELEKLKRNTKPGAQDGKKIMDGELDDEEAAIEEARYAEESDMGRQQSTATRNLRIREDTAKYLLNLDLDSAKYDPKTRRMVDMGAQDD 225          
BLAST of FC924894 vs. ExPASy Swiss-Prot
Match: SLU7_CRYNE (Pre-mRNA-splicing factor SLU7 OS=Cryptococcus neoformans GN=SLU7 PE=3 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 3.731e-17
Identity = 50/112 (44.64%), Postives = 66/112 (58.93%), Query Frame = 3
Query:  102 APASVGSKSTVDWEEINTHVPLYMKHAPWYAKSEVPDNLKHQRKQKESLQSNINLCYDRGAKTFQA-D*YRKGACENCEAMSHNANSIMERPRKRRAILTNMRIAADEKIEK 434
            APA++  +       IN H+P Y+  APWYA +  P +L HQR  ++     ++  YDRGAK   A   YRKGACENC AM+H     +ERPRKR A  TN  IA DE +++
Sbjct:   33 APAALDEQGNA----INPHIPEYITKAPWYADTGRP-SLAHQRINEQGPHLKLDEWYDRGAKAGPAAKKYRKGACENCGAMTHKMKDCVERPRKRGAKFTNKDIAPDELVQQ 139          
BLAST of FC924894 vs. ExPASy Swiss-Prot
Match: SLU7_MAGGR (Pre-mRNA-splicing factor SLU7 OS=Magnaporthe grisea GN=SLU7 PE=3 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 6.365e-17
Identity = 68/201 (33.83%), Postives = 95/201 (47.26%), Query Frame = 3
Query:  141 EEINTHVPLYMKHAPWYA--KSEVPDNLKHQRKQKESLQSNINLCYDRGAKTF--QAD*YRKGACENCEAMSHNANSIMERPRKRRAILTNMRIAADEKIEKIVM-IQQSMPVMSVRDMKLITKMV*SLMRVTLRILPQVKKGVCGNGSGITG----------------TNRDLRIREDIPKYLLNLDENSAYYDPKIRSM 680
            +E N ++P ++   P+YA  + E  D L+HQR QK+   +     YDRG KT    A  YRKGACENC AM+H     + RPR + A  T   I ADE ++ + M         +  D +    +V    ++         K    +G  I                  + R LR+RED  KYLLNLD +SA YDPK R++
Sbjct:   20 KEENVYIPNFISKRPFYAVDEGENTDYLEHQRIQKKEKDTG---WYDRG-KTLGPAATKYRKGACENCGAMTHKVKDCLSRPRAKGAKWTGRDIKADELVQDVRMGWDAKRDRWNGYDAREYQAVVEDYNKMEELRKEMQAKAAAESGKAIEDGDHYAETSDMSKHQPTSTRQLRLREDTAKYLLNLDLDSAKYDPKTRTI 216          
The following BLAST results are available for this feature:
BLAST of FC924894 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 21
Match NameE-valueIdentityDescription
SLU7_ORYSJ9.445e-3740.08Pre-mRNA-splicing factor SLU7 OS=Oryza sativa subs... [more]
SLU7_ORYSI9.445e-3740.08Pre-mRNA-splicing factor SLU7 OS=Oryza sativa subs... [more]
SLU7_CHICK9.796e-2636.76Pre-mRNA-splicing factor SLU7 OS=Gallus gallus GN=... [more]
SLU7A_ARATH2.850e-2556.76Pre-mRNA-splicing factor SLU7-A OS=Arabidopsis tha... [more]
SLU7B_ARATH7.021e-2454.05Pre-mRNA-splicing factor SLU7-B OS=Arabidopsis tha... [more]
SLU7_DROME1.729e-2234.21Pre-mRNA-splicing factor Slu7 OS=Drosophila melano... [more]
SLU7_CAEEL1.049e-1931.78Pre-mRNA-splicing factor SLU7 OS=Caenorhabditis el... [more]
SLU7_ASPFU2.187e-1731.88Pre-mRNA-splicing factor slu7 OS=Aspergillus fumig... [more]
SLU7_CRYNE3.731e-1744.64Pre-mRNA-splicing factor SLU7 OS=Cryptococcus neof... [more]
SLU7_MAGGR6.365e-1733.83Pre-mRNA-splicing factor SLU7 OS=Magnaporthe grise... [more]

Pages

back to top
Libraries
Library NameType
TFcdna_library
Properties
Property NameValue
Genbank descriptionKN0AAP1YL08FM1 TF Citrus clementina cDNA clone KN0AAP1YL08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC924894 ID=FC924894|Name=FC924894|organism=Citrus clementina|type=EST|length=725bp
AATCTCCATACGGATGCTAGGGTTAGTTTTTAGTTGTCGCCTTCTTCAAA
ATTAATCTTCTAATAAGTGTTGGCTCTAGGGTTTGCAATCTCATCGAGAT
GGCTCCTGCTTCAGTGGGATCCAAATCAACGGTAGATTGGGAAGAAATCA
ACACACATGTTCCTCTGTATATGAAGCATGCGCCTTGGTATGCAAAGTCT
GAGGTACCAGATAACTTGAAACACCAAAGAAAACAGAAAGAATCACTTCA
GAGCAACATAAACTTGTGTTATGATAGAGGTGCCAAAACTTTCCAGGCGG
ACTAGTACAGGAAAGGAGCGTGTGAAAACTGCGAAGCAATGTCACATAAT
GCTAATTCAATCATGGAAAGGCCGAGAAAAAGAAGAGCAATATTGACAAA
CATGCGCATTGCAGCAGATGAAAAGATAGAGAAGATTGTTATGATCCAGC
AAAGTATGCCCGTGATGTCAGTAAGAGACATGAAGCTTATAACGAAGATG
GTTTGAAGCTTGATGAGAGTGACACTACGAATTTTGCCCCAAGTTAAGAA
GGGTGTTTGTGGTAATGGCAGTGGAATCACGGGAACTAATAGAGATTTGC
GTATTCGTGAAGATATACCTAAGTATCTCCTGAATCTTGATGAAAATTCC
GCATATTATGATCCAAAAATTCGGTCTATGCGGGAGGATCTCAACCCTGA
TGACAATCCGAATGAAAAGTTCTAT
back to top