FC928837

Overview
NameFC928837
Unique NameFC928837
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length780
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9256 contig Ccv1_Contig9256:11..790. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC928837 vs. ExPASy Swiss-Prot
Match: YPTM2_MAIZE (GTP-binding protein YPTM2 OS=Zea mays GN=YPTM2 PE=2 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 4.842e-21
Identity = 49/54 (90.74%), Postives = 51/54 (94.44%), Query Frame = 1
Query:   25 IVYDVTDQESFNNVKQWLNEIDRYASDNVNKLLVGNKCDLTANKVVSYETAKVY 186
            IVYDVTDQESFNNVKQWLNEIDRYASDNVNKLLVGNK DLTANKVV+ ETAK +
Sbjct:   86 IVYDVTDQESFNNVKQWLNEIDRYASDNVNKLLVGNKSDLTANKVVATETAKAF 139          
BLAST of FC928837 vs. ExPASy Swiss-Prot
Match: RIC1_ORYSJ (Ras-related protein RIC1 OS=Oryza sativa subsp. japonica GN=RIC1 PE=2 SV=2)

HSP 1 Score: 98.5969 bits (244), Expect = 4.099e-20
Identity = 45/52 (86.54%), Postives = 48/52 (92.31%), Query Frame = 1
Query:   25 IVYDVTDQESFNNVKQWLNEIDRYASDNVNKLLVGNKCDLTANKVVSYETAK 180
            +VYDVTDQESFNNVKQWLNEIDRYAS+NVNKLLVGNKCDL  N+VVSYE  K
Sbjct:   86 VVYDVTDQESFNNVKQWLNEIDRYASENVNKLLVGNKCDLAENRVVSYEAGK 137          
BLAST of FC928837 vs. ExPASy Swiss-Prot
Match: RAB1_DISOM (Ras-related protein ORAB-1 OS=Discopyge ommata PE=2 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 9.133e-20
Identity = 45/54 (83.33%), Postives = 48/54 (88.89%), Query Frame = 1
Query:   25 IVYDVTDQESFNNVKQWLNEIDRYASDNVNKLLVGNKCDLTANKVVSYETAKVY 186
            +VYDVTDQESFNNVKQWL EIDRYAS+NVNKLLVGNKCDLT  KVV Y TAK +
Sbjct:   86 VVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEF 139          
BLAST of FC928837 vs. ExPASy Swiss-Prot
Match: RAB1A_RAT (Ras-related protein Rab-1A OS=Rattus norvegicus GN=Rab1A PE=1 SV=3)

HSP 1 Score: 97.4413 bits (241), Expect = 9.133e-20
Identity = 45/54 (83.33%), Postives = 48/54 (88.89%), Query Frame = 1
Query:   25 IVYDVTDQESFNNVKQWLNEIDRYASDNVNKLLVGNKCDLTANKVVSYETAKVY 186
            +VYDVTDQESFNNVKQWL EIDRYAS+NVNKLLVGNKCDLT  KVV Y TAK +
Sbjct:   89 VVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEF 142          
BLAST of FC928837 vs. ExPASy Swiss-Prot
Match: RAB1A_MOUSE (Ras-related protein Rab-1A OS=Mus musculus GN=Rab1A PE=1 SV=3)

HSP 1 Score: 97.4413 bits (241), Expect = 9.133e-20
Identity = 45/54 (83.33%), Postives = 48/54 (88.89%), Query Frame = 1
Query:   25 IVYDVTDQESFNNVKQWLNEIDRYASDNVNKLLVGNKCDLTANKVVSYETAKVY 186
            +VYDVTDQESFNNVKQWL EIDRYAS+NVNKLLVGNKCDLT  KVV Y TAK +
Sbjct:   89 VVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEF 142          
BLAST of FC928837 vs. ExPASy Swiss-Prot
Match: RAB1A_HUMAN (Ras-related protein Rab-1A OS=Homo sapiens GN=RAB1A PE=1 SV=3)

HSP 1 Score: 97.4413 bits (241), Expect = 9.133e-20
Identity = 45/54 (83.33%), Postives = 48/54 (88.89%), Query Frame = 1
Query:   25 IVYDVTDQESFNNVKQWLNEIDRYASDNVNKLLVGNKCDLTANKVVSYETAKVY 186
            +VYDVTDQESFNNVKQWL EIDRYAS+NVNKLLVGNKCDLT  KVV Y TAK +
Sbjct:   89 VVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEF 142          
BLAST of FC928837 vs. ExPASy Swiss-Prot
Match: RAB1A_CANFA (Ras-related protein Rab-1A OS=Canis familiaris GN=RAB1A PE=1 SV=3)

HSP 1 Score: 97.4413 bits (241), Expect = 9.133e-20
Identity = 45/54 (83.33%), Postives = 48/54 (88.89%), Query Frame = 1
Query:   25 IVYDVTDQESFNNVKQWLNEIDRYASDNVNKLLVGNKCDLTANKVVSYETAKVY 186
            +VYDVTDQESFNNVKQWL EIDRYAS+NVNKLLVGNKCDLT  KVV Y TAK +
Sbjct:   89 VVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEF 142          
BLAST of FC928837 vs. ExPASy Swiss-Prot
Match: RBD2A_ARATH (Ras-related protein RABD2A OS=Arabidopsis thaliana GN=RABD2A PE=1 SV=3)

HSP 1 Score: 96.2857 bits (238), Expect = 2.035e-19
Identity = 44/54 (81.48%), Postives = 49/54 (90.74%), Query Frame = 1
Query:   25 IVYDVTDQESFNNVKQWLNEIDRYASDNVNKLLVGNKCDLTANKVVSYETAKVY 186
            IVYDVTD+ESFNNVKQWL+EIDRYASDNVNKLLVGNK DLT N+ + YETAK +
Sbjct:   86 IVYDVTDEESFNNVKQWLSEIDRYASDNVNKLLVGNKSDLTENRAIPYETAKAF 139          
BLAST of FC928837 vs. ExPASy Swiss-Prot
Match: YPTC1_CHLRE (GTP-binding protein YPTC1 OS=Chlamydomonas reinhardtii GN=YPTC1 PE=3 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 3.470e-19
Identity = 44/54 (81.48%), Postives = 48/54 (88.89%), Query Frame = 1
Query:   25 IVYDVTDQESFNNVKQWLNEIDRYASDNVNKLLVGNKCDLTANKVVSYETAKVY 186
            +VYDVTDQESFNNVKQWLNEIDRYAS+NVNKLLVGNK DLT+ KVV Y  AK +
Sbjct:   86 VVYDVTDQESFNNVKQWLNEIDRYASENVNKLLVGNKSDLTSKKVVEYSVAKAF 139          
BLAST of FC928837 vs. ExPASy Swiss-Prot
Match: RAB1A_PIG (Ras-related protein Rab-1A OS=Sus scrofa GN=RAB1A PE=2 SV=3)

HSP 1 Score: 94.7449 bits (234), Expect = 5.920e-19
Identity = 44/54 (81.48%), Postives = 47/54 (87.04%), Query Frame = 1
Query:   25 IVYDVTDQESFNNVKQWLNEIDRYASDNVNKLLVGNKCDLTANKVVSYETAKVY 186
            +VYDVTDQ SFNNVKQWL EIDRYAS+NVNKLLVGNKCDLT  KVV Y TAK +
Sbjct:   89 VVYDVTDQGSFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEF 142          
The following BLAST results are available for this feature:
BLAST of FC928837 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 32
Match NameE-valueIdentityDescription
YPTM2_MAIZE4.842e-2190.74GTP-binding protein YPTM2 OS=Zea mays GN=YPTM2 PE=... [more]
RIC1_ORYSJ4.099e-2086.54Ras-related protein RIC1 OS=Oryza sativa subsp. ja... [more]
RAB1_DISOM9.133e-2083.33Ras-related protein ORAB-1 OS=Discopyge ommata PE=... [more]
RAB1A_RAT9.133e-2083.33Ras-related protein Rab-1A OS=Rattus norvegicus GN... [more]
RAB1A_MOUSE9.133e-2083.33Ras-related protein Rab-1A OS=Mus musculus GN=Rab1... [more]
RAB1A_HUMAN9.133e-2083.33Ras-related protein Rab-1A OS=Homo sapiens GN=RAB1... [more]
RAB1A_CANFA9.133e-2083.33Ras-related protein Rab-1A OS=Canis familiaris GN=... [more]
RBD2A_ARATH2.035e-1981.48Ras-related protein RABD2A OS=Arabidopsis thaliana... [more]
YPTC1_CHLRE3.470e-1981.48GTP-binding protein YPTC1 OS=Chlamydomonas reinhar... [more]
RAB1A_PIG5.920e-1981.48Ras-related protein Rab-1A OS=Sus scrofa GN=RAB1A ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH3AH03RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH3AH03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC928837 ID=FC928837|Name=FC928837|organism=Citrus clementina|type=EST|length=780bp
GGCACGAGGTGTCTCCTCTGGTAGATTGTTTATGATGTGACAGACCAAGA
GAGCTTCAATAATGTCAAGCAGTGGTTGAATGAAATTGACCGTTATGCTA
GTGATAATGTCAACAAACTTCTGGTTGGAAACAAGTGTGATCTCACTGCA
AATAAGGTTGTCTCGTACGAAACAGCCAAGGTATATCTACTTCTCTACAC
TGGCATTTTCTTTTTTTACCCCTCCCCTTAACAAGGTTCAAGCCACTTCC
TCCCCCCTCCAAATTATGTGTCAAAGTAAATTTTGTATAATGATCCGAAA
TTGCTATTTCCACCATTCTTAATGGTGAACCTTTATGTCGATTCGTATTG
CATTCATCAAGATAGTCTTTAGTTGCTGGCCAGTAAAGGCACTAGAGTTT
GAGTTGGATAAAAAGCCTTCCTTCAAAGATTATAACTCGAAGACTCCTTA
CCTTAGGAGCTGGATAAGTGATACATCTGGCGAGCATTCTGTTGACCCCT
TGTACTCTTCTTCTTTATTAGGCATTTGCAGATGAAATTGGAATACCTTT
CATGGAAACTAGTGCAAAAGATTCTACCAACGTGGAACAGGCATTCATGG
CCATGGCTGCTTCAATCAAGGATAGGTATTGATGCATATTTGCTTTCTAT
ATTAAACGCGAAATAGATTGATAGGAGTATTGTGTTTTGCCTTCTTTTTG
AAGAAGTCTTCAGATTACGTAACGCCATAACTTCATACAGTTACTTATAT
TACCTGCTATATTTGTTTTCTATATTAAAC
back to top