FC928859

Overview
NameFC928859
Unique NameFC928859
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length761
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10403 contig Ccv1_Contig10403:786..1546. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC928859 vs. ExPASy Swiss-Prot
Match: RBOHC_ARATH (Respiratory burst oxidase homolog protein C OS=Arabidopsis thaliana GN=RBOHC PE=2 SV=2)

HSP 1 Score: 92.4337 bits (228), Expect = 2.828e-18
Identity = 39/48 (81.25%), Postives = 47/48 (97.92%), Query Frame = 1
Query:    1 KRVALNHPDSRVGVFYCGAPALTKELRHLALDFSHKTSTKFDFHKENF 144
            KR+A++HP+++VGVFYCGAPALTKELRHLALDF+HKTST+F FHKENF
Sbjct:  858 KRIAMDHPNTKVGVFYCGAPALTKELRHLALDFTHKTSTRFSFHKENF 905          
BLAST of FC928859 vs. ExPASy Swiss-Prot
Match: RBOHD_SOLTU (Respiratory burst oxidase homolog protein D OS=Solanum tuberosum GN=RBOHD PE=1 SV=2)

HSP 1 Score: 91.2781 bits (225), Expect = 6.300e-18
Identity = 42/48 (87.50%), Postives = 44/48 (91.67%), Query Frame = 1
Query:    1 KRVALNHPDSRVGVFYCGAPALTKELRHLALDFSHKTSTKFDFHKENF 144
            KR+ALNH D+RVGVFYCGAPALTK L  LALDFSHKTSTKFDFHKENF
Sbjct:  811 KRIALNHTDARVGVFYCGAPALTKVLGQLALDFSHKTSTKFDFHKENF 858          
BLAST of FC928859 vs. ExPASy Swiss-Prot
Match: RBOHC_SOLTU (Respiratory burst oxidase homolog protein C OS=Solanum tuberosum GN=RBOHC PE=1 SV=2)

HSP 1 Score: 91.2781 bits (225), Expect = 6.300e-18
Identity = 40/48 (83.33%), Postives = 46/48 (95.83%), Query Frame = 1
Query:    1 KRVALNHPDSRVGVFYCGAPALTKELRHLALDFSHKTSTKFDFHKENF 144
            KR+ALNHP+++VGVFYCGAPALTKEL+  AL+FSHKTSTKFDFHKENF
Sbjct:  891 KRIALNHPEAKVGVFYCGAPALTKELKQHALNFSHKTSTKFDFHKENF 938          
BLAST of FC928859 vs. ExPASy Swiss-Prot
Match: RBOHA_ARATH (Respiratory burst oxidase homolog protein A OS=Arabidopsis thaliana GN=RBOHA PE=2 SV=2)

HSP 1 Score: 87.8113 bits (216), Expect = 6.966e-17
Identity = 39/48 (81.25%), Postives = 43/48 (89.58%), Query Frame = 1
Query:    1 KRVALNHPDSRVGVFYCGAPALTKELRHLALDFSHKTSTKFDFHKENF 144
            KR+A+NHP +RVGVFYCGA  L KELRHL+LDFSHKTSTKF FHKENF
Sbjct:  855 KRIAVNHPKTRVGVFYCGAAGLVKELRHLSLDFSHKTSTKFIFHKENF 902          
BLAST of FC928859 vs. ExPASy Swiss-Prot
Match: RBOHG_ARATH (Putative respiratory burst oxidase homolog protein G OS=Arabidopsis thaliana GN=RBOHG PE=2 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.716e-15
Identity = 35/48 (72.92%), Postives = 43/48 (89.58%), Query Frame = 1
Query:    1 KRVALNHPDSRVGVFYCGAPALTKELRHLALDFSHKTSTKFDFHKENF 144
            K++A++HP + VGVFYCGAP LTKELR LAL+F+HKTST+F FHKENF
Sbjct:  816 KQIAMDHPGANVGVFYCGAPVLTKELRQLALEFTHKTSTRFSFHKENF 863          
BLAST of FC928859 vs. ExPASy Swiss-Prot
Match: RBOHB_SOLTU (Respiratory burst oxidase homolog protein B OS=Solanum tuberosum GN=RBOHB PE=1 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 2.927e-15
Identity = 35/48 (72.92%), Postives = 39/48 (81.25%), Query Frame = 1
Query:    1 KRVALNHPDSRVGVFYCGAPALTKELRHLALDFSHKTSTKFDFHKENF 144
            KRV +NHPD R+GVFYCG   L  ELRHL+ DFSHKT TKF+FHKENF
Sbjct:  820 KRVTINHPDQRIGVFYCGPQGLVGELRHLSQDFSHKTGTKFEFHKENF 867          
BLAST of FC928859 vs. ExPASy Swiss-Prot
Match: RBOHD_ARATH (Respiratory burst oxidase homolog protein D OS=Arabidopsis thaliana GN=RBOHD PE=1 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.452e-14
Identity = 33/48 (68.75%), Postives = 41/48 (85.42%), Query Frame = 1
Query:    1 KRVALNHPDSRVGVFYCGAPALTKELRHLALDFSHKTSTKFDFHKENF 144
            K++A+ HP  R+GVFYCG P + KEL++LALDFS KT+TKFDFHKENF
Sbjct:  874 KKIAVQHPGKRIGVFYCGMPGMIKELKNLALDFSRKTTTKFDFHKENF 921          
BLAST of FC928859 vs. ExPASy Swiss-Prot
Match: RBOHB_ARATH (Respiratory burst oxidase homolog protein B OS=Arabidopsis thaliana GN=RBOHB PE=2 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 2.564e-11
Identity = 31/48 (64.58%), Postives = 37/48 (77.08%), Query Frame = 1
Query:    1 KRVALNHPDSRVGVFYCGAPALTKELRHLALDFSHKTSTKFDFHKENF 144
            K VA+NH + RVGVFYCG   +  EL+ LA DFS KT+TKF+FHKENF
Sbjct:  796 KHVAVNHVNQRVGVFYCGNTCIIGELKRLAQDFSRKTTTKFEFHKENF 843          
The following BLAST results are available for this feature:
BLAST of FC928859 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 8
Match NameE-valueIdentityDescription
RBOHC_ARATH2.828e-1881.25Respiratory burst oxidase homolog protein C OS=Ara... [more]
RBOHD_SOLTU6.300e-1887.50Respiratory burst oxidase homolog protein D OS=Sol... [more]
RBOHC_SOLTU6.300e-1883.33Respiratory burst oxidase homolog protein C OS=Sol... [more]
RBOHA_ARATH6.966e-1781.25Respiratory burst oxidase homolog protein A OS=Ara... [more]
RBOHG_ARATH1.716e-1572.92Putative respiratory burst oxidase homolog protein... [more]
RBOHB_SOLTU2.927e-1572.92Respiratory burst oxidase homolog protein B OS=Sol... [more]
RBOHD_ARATH1.452e-1468.75Respiratory burst oxidase homolog protein D OS=Ara... [more]
RBOHB_ARATH2.564e-1164.58Respiratory burst oxidase homolog protein B OS=Ara... [more]
back to top
Properties
Property NameValue
Genbank descriptionKN0AAH1CB02RM2 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH1CB02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC928859 ID=FC928859|Name=FC928859|organism=Citrus clementina|type=EST|length=761bp
AAACGCGTTGCTCTCAATCACCCTGATTCTAGAGTTGGTGTTTTCTATTG
CGGGGCACCGGCACTGACAAAAGAGCTACGACACCTAGCTTTGGATTTCT
CTCACAAGACAAGCACCAAGTTTGATTTCCATAAAGAAAACTTCTAGATC
AAGTCCCTCCTGATTTCCACCATTATATATCATCTCTTCCACTCCGTTTT
CTCGTACAAAGCCTGTGGCATGGCCCACTGGCCCTTATGTTTATAGAAAA
ATCATATCAATATTTGTTTGGTACCCAGTTGATTTTGCTGCAAAATCACT
AATAGAGAGCATTAGAAATATCAAGCGGACAAAGGTTGGTGGGTAGTTGA
TATCAAGGCCACACCACACTGGACACACAACACATGGCAAGGGAGATATA
GGCCGAAAAAGGGGTTTAGCAAAAAAGTCATGCTCAGCCATTTCCTTTTG
TTAAAAGTTGTGGTCCAAGCCAATAATTTTGTGAGAAATAGTAATAATGG
CAGCCTGGCAGCCACCACTAATAATGGCAGCCTGGCAGCCACCACCAACT
CAGTCCTTAACAGCCAAATGTAAAAGGGTTTTTGTTTTGTTTTCTTTTCT
TTTTGGTTGGAGTAATTTGTTGTTTTATTTGATTAATTAAAGTTGCGATG
TCAATTGAATGGGGTCGTAAGCCCTTTAAAATGTAAGTATGTATTGAATA
ATTAGTTCGGAGTACACTTTACCCAATTTCTTATGTTTCAAAAAAAAAAA
AAAAAAAAAAA
back to top