FC928877

Overview
NameFC928877
Unique NameFC928877
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length606
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9543 contig Ccv1_Contig9543:25..630. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC928877 vs. ExPASy Swiss-Prot
Match: TOM7A_ARATH (Mitochondrial import receptor subunit TOM7-1 OS=Arabidopsis thaliana GN=TOM7-1 PE=1 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 1.372e-21
Identity = 47/75 (62.67%), Postives = 60/75 (80.00%), Query Frame = 2
Query:   71 MGSRVTLRT---KGKGVKGAKASEEKSMIDSFKEWSTWTMKKAKVVTHYGFIPLIIIIGMNSDPKPQVYQLLSPV 286
            M S ++L+    KGKG KGA +S++KS  D  KEW+ W++KKAKVVTHYGFIPL+I +GMNSDPKP ++QLLSPV
Sbjct:    1 MESTISLKVNKGKGKGSKGASSSDDKSKFDVVKEWTNWSLKKAKVVTHYGFIPLVIFVGMNSDPKPHLFQLLSPV 75          
BLAST of FC928877 vs. ExPASy Swiss-Prot
Match: TOM7A_SOLTU (Mitochondrial import receptor subunit TOM7-1 OS=Solanum tuberosum GN=TOM7-1 PE=3 SV=3)

HSP 1 Score: 88.9669 bits (219), Expect = 2.050e-17
Identity = 44/71 (61.97%), Postives = 54/71 (76.06%), Query Frame = 2
Query:   89 LRTKGKGVKGAKASEEK----SMIDSF-KEWSTWTMKKAKVVTHYGFIPLIIIIGMNSDPKPQVYQLLSPV 286
            L+ KGK  K A A++E     +++  F KEW TWT KKAKV+THYGFIPL+IIIGMNS+PKP + QLLSPV
Sbjct:    2 LKPKGKNTKKAAAADEDDGAVAVVGKFVKEWGTWTAKKAKVITHYGFIPLVIIIGMNSEPKPSLSQLLSPV 72          
BLAST of FC928877 vs. ExPASy Swiss-Prot
Match: TOM7B_ARATH (Mitochondrial import receptor subunit TOM7-2 OS=Arabidopsis thaliana GN=TOM7-2 PE=3 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 2.678e-17
Identity = 42/77 (54.55%), Postives = 54/77 (70.13%), Query Frame = 2
Query:   71 MGSRVTLRTKGK-----GVKGAKASEEKSMIDSFKEWSTWTMKKAKVVTHYGFIPLIIIIGMNSDPKPQVYQLLSPV 286
            M ++ TL+ KGK     G   + +S   S    FK+W+ W+++KAKV THYGFIPLIIIIGMNSDPKP ++ LLSPV
Sbjct:    1 MAAKSTLKIKGKAKPSKGSSSSSSSSASSKYKVFKDWTNWSLQKAKVATHYGFIPLIIIIGMNSDPKPHLFHLLSPV 77          
The following BLAST results are available for this feature:
BLAST of FC928877 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
TOM7A_ARATH1.372e-2162.67Mitochondrial import receptor subunit TOM7-1 OS=Ar... [more]
TOM7A_SOLTU2.050e-1761.97Mitochondrial import receptor subunit TOM7-1 OS=So... [more]
TOM7B_ARATH2.678e-1754.55Mitochondrial import receptor subunit TOM7-2 OS=Ar... [more]
back to top
Libraries
Library NameType
PhII-IIIV1cdna_library
Properties
Property NameValue
Genbank descriptionKN0AAH1CC08RM2 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH1CC08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC928877 ID=FC928877|Name=FC928877|organism=Citrus clementina|type=EST|length=606bp
GGCACGAGGAGCCTCCTCTCAACACAACGTTCAAGCCGTTCACCGCAGCA
GGTCAAGATTTGAGGAGAAAATGGGTTCTAGAGTAACACTTAGGACCAAA
GGCAAGGGCGTGAAGGGAGCAAAGGCATCAGAGGAGAAATCAATGATCGA
TTCTTTCAAAGAGTGGAGCACTTGGACCATGAAAAAGGCTAAAGTGGTCA
CTCACTATGGATTTATTCCTCTTATCATCATTATCGGCATGAATTCTGAT
CCCAAGCCCCAAGTCTATCAGCTCCTCAGCCCCGTTTGATCTCCATACTT
GACTCTTCCTTTTCTTTTGATGTCAAACAAAATAGTTATTGTCATGCTGT
GCCTTCCTATTTGTCGAATCTACATGAATTGAATGTTTTAGGAGTTTTGG
TTTCTTGTGATCGTACTTCCTGCCTAGTTGTAAGCTTATGGATTGACTAG
TATAAAATGTCTGGAATTTGAATTATATACCGTCTCCATTGAATTGGAGG
CTTCTTTTTCTTTTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAA
back to top