FC928887

Overview
NameFC928887
Unique NameFC928887
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length619
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig135 contig Ccv1_Contig135:528..1146. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC928887 vs. ExPASy Swiss-Prot
Match: TLC1_SOLTU (Plastidic ATP/ADP-transporter OS=Solanum tuberosum PE=2 SV=2)

HSP 1 Score: 159.844 bits (403), Expect = 9.732e-39
Identity = 86/121 (71.07%), Postives = 95/121 (78.51%), Query Frame = 3
Query:    9 VKGKAAIYVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIVLAWLGAARSLDTQFTALRQXXXXXXXXXRAAVKIPVVSENEGGNGTLPGGSTLNAAG----ETPSEASSPRNI 359
            VKGKAAI VVCNPLGKSGGALIQQFMILTFGSLA+STPYLGG+LLVIVLAWLGAA+SLD QFT LRQ         RA++KIPVVS+NE GNG L   S+LN AG       SE SSPR++
Sbjct:  511 VKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLASSTPYLGGVLLVIVLAWLGAAKSLDGQFTQLRQEEDLEKEMERASLKIPVVSQNENGNGPLSSESSLNPAGGDSTNASSEPSSPRSL 631          
BLAST of FC928887 vs. ExPASy Swiss-Prot
Match: TLC1_ARATH (ADP,ATP carrier protein 1, chloroplastic OS=Arabidopsis thaliana GN=AATP1 PE=1 SV=2)

HSP 1 Score: 134.42 bits (337), Expect = 4.379e-31
Identity = 78/121 (64.46%), Postives = 89/121 (73.55%), Query Frame = 3
Query:    9 VKGKAAIYVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIVLAWLGAARSLDTQFTALRQXXXXXXXXXRA-AVKIPVVSENEGGNGTLPGGSTLNAAGETPS---EASSPRNI 359
            VKGKAAI VVCNPLGKSGGALIQQFMIL+FGSLANSTPYLG ILLVIV AWL AA+SL+ QF +LR          RA +VKIPVVS++E GNG+L         GE+PS   E S+P N+
Sbjct:  513 VKGKAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGMILLVIVTAWLAAAKSLEGQFNSLRSEEELEKEMERASSVKIPVVSQDESGNGSL---------GESPSSSPEKSAPTNL 624          
BLAST of FC928887 vs. ExPASy Swiss-Prot
Match: TLC2_ARATH (ADP,ATP carrier protein 2, chloroplastic OS=Arabidopsis thaliana GN=AATP2 PE=1 SV=2)

HSP 1 Score: 118.627 bits (296), Expect = 2.486e-26
Identity = 72/118 (61.02%), Postives = 79/118 (66.95%), Query Frame = 3
Query:    9 VKGKAAIYVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIVLAWLGAARSLDTQFTALRQXXXXXXXXXRA-AVKIPVVSENEGGNGTLPGGSTLNAAGETPSEASSPRNI 359
            VKGKAAI VVCNPLGKSGGALIQQFMILTFGSLANSTPYLG ILL IV AWL AA+SL+ QF  L           RA +VKIPVVS+ +      P G T +      SE S+P  I
Sbjct:  510 VKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGVILLGIVTAWLAAAKSLEGQFNTLMSEEELEREMERASSVKIPVVSQEDA-----PSGETTSQL----SEKSTPTGI 618          
The following BLAST results are available for this feature:
BLAST of FC928887 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
TLC1_SOLTU9.732e-3971.07Plastidic ATP/ADP-transporter OS=Solanum tuberosum... [more]
TLC1_ARATH4.379e-3164.46ADP,ATP carrier protein 1, chloroplastic OS=Arabid... [more]
TLC2_ARATH2.486e-2661.02ADP,ATP carrier protein 2, chloroplastic OS=Arabid... [more]
back to top
Properties
Property NameValue
Genbank descriptionKN0AAH1CD07RM2 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH1CD07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC928887 ID=FC928887|Name=FC928887|organism=Citrus clementina|type=EST|length=619bp
TTTGTTAGGTTAAAGGGAAGGCAGCCATCTATGTTGTGTGCAACCCGTTG
GGGAAATCTGGAGGAGCTCTTATTCAGCAGTTTATGATATTAACCTTTGG
GTCCCTTGCGAATTCAACTCCTTATCTTGGAGGGATACTTTTGGTGATTG
TTCTTGCATGGTTAGGAGCAGCCAGGTCTTTAGATACCCAATTTACAGCT
TTGCGTCAGGAAGAAGAGCTTGAGAAGGAGATGGAAAGAGCTGCTGTTAA
AATCCCAGTTGTCTCTGAAAATGAAGGCGGGAATGGTACTCTTCCAGGTG
GATCAACTTTGAATGCAGCAGGTGAGACACCCAGTGAAGCATCTAGTCCA
CGCAATATCTGAAATAGTTTCTTCCAATTCCTTGCCGCATGAAGAATGAG
AAGCATCAATACTTGAGGTATTGCTTGTAGGATCTTCTCAAATTACACAA
ATAATAGTAGCTAAACAAAGTATGAGCCCGTCTGTCTTAATTCCGCCTTT
TTCCCGTAGATAATGAGTTTAGTATCTGTTTACTCATACATTCATGTTCT
TTGTAGAATTCGAATTTGGTTTTTTATTGATAGCAACAACATTAAATTTA
ATAAAAAAAAAAAAAAAAA
back to top