FC929016

Overview
NameFC929016
Unique NameFC929016
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length844
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15284 contig Ccv1_Contig15284:62..906. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929016 vs. ExPASy Swiss-Prot
Match: ADS3_ARATH (Palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, chloroplastic OS=Arabidopsis thaliana GN=ADS3 PE=2 SV=2)

HSP 1 Score: 307.76 bits (787), Expect = 5.041e-83
Identity = 136/195 (69.74%), Postives = 162/195 (83.08%), Query Frame = 2
Query:  230 YGRILLSDVLVKRRRSL-FSGRNWNSLDISTAGVVLAMHLLALFAPFCFTWSSLRVAFGLYVVTGLLGITLSFHRNLSHRSFKLPKWLEYLFAYCGVQSLQGNPIDWVSTHRYHHQFCDSERDPHSPIEGFWFSHMSWLFDKDSVLERCGGPNNVGDLEKQPFYRFLRSTYILHPIXXXXXXXXXXXFPFIVWGM 811
            Y RI+LSDVLVK++  + +  R W ++D     VVL+MHLL+L APF F W ++ VAFGLY+VTGLLGITLSFHRNLSH++FKLPKWLEYLFAYCG Q+LQGNPIDWVSTHRYHHQFCDS+RDPHSP++GFWFSHM+W+FD +++ +RCG PNNVGDLEKQPFYRFLR+TYILHP+           FPFIVWGM
Sbjct:   75 YRRIMLSDVLVKKKEKVVWWEREWKAMDFGAVAVVLSMHLLSLLAPFQFNWRAVSVAFGLYIVTGLLGITLSFHRNLSHKAFKLPKWLEYLFAYCGAQALQGNPIDWVSTHRYHHQFCDSDRDPHSPLDGFWFSHMNWMFDTNTITQRCGEPNNVGDLEKQPFYRFLRTTYILHPLALAVALYAMGGFPFIVWGM 269          
BLAST of FC929016 vs. ExPASy Swiss-Prot
Match: ADS32_ARATH (Probable lipid desaturase ADS3.2, chloroplastic OS=Arabidopsis thaliana GN=ADS3.2 PE=2 SV=3)

HSP 1 Score: 228.794 bits (582), Expect = 2.976e-59
Identity = 108/204 (52.94%), Postives = 138/204 (67.65%), Query Frame = 2
Query:  236 RILLSDVLVKRRRSLFSGRNWNSLDISTAGVVLAMHLLALFAPFCFTWSSLRVAFGLYVVTGLLGITLSFHRNLSHRSFKLPKWLEYLFAYCGVQSLQGNPIDWVSTHRYHHQFCDSERDPHSPIEGFWFSHMSWLFDKDSVLERCGGPNNVGDLEKQPFYRFLRSTYILHPIXXXXXXXXXXXFPFIVWGM-----VRKHFPF 832
            R LLS+V+V R +  F  R+W S D+S   + +  HLL+L APF F+W +  V   L  + G+  ITLS+HRNLSHRSF LPKWLEYLFAY GV + QG+PI+WVS HRYHH+ C+++RDPHSP +GFWFSHM+W+FD  S+LE CGG  NV DL +QPFYRFL+ T +LH +            P +VWG+     VR H  F
Sbjct:   71 RRLLSEVVVVRTKRSFWERSWTSWDVSKLVIFVGTHLLSLLAPFYFSWEAFWVFPWLVFINGIC-ITLSYHRNLSHRSFDLPKWLEYLFAYGGVLAFQGDPIEWVSNHRYHHKHCETQRDPHSPTQGFWFSHMAWIFDTSSILENCGGEENVDDLVRQPFYRFLQRTVLLHMMAYSFLFYFCGGMPLLVWGIGITIAVRLHLTF 273          
BLAST of FC929016 vs. ExPASy Swiss-Prot
Match: ADS1_ARATH (Delta-9 acyl-lipid desaturase 1 OS=Arabidopsis thaliana GN=ADS1 PE=2 SV=1)

HSP 1 Score: 220.705 bits (561), Expect = 8.105e-57
Identity = 101/183 (55.19%), Postives = 131/183 (71.58%), Query Frame = 2
Query:  263 KRRRSLFSGRNWNSLDISTAGVVLAMHLLALFAPFCFTWSSLRVAFGLYVVTGLLGITLSFHRNLSHRSFKLPKWLEYLFAYCGVQSLQGNPIDWVSTHRYHHQFCDSERDPHSPIEGFWFSHMSWLFDKDSVLERCGGPNNVGDLEKQPFYRFLRSTYILHPIXXXXXXXXXXXFPFIVWGM 811
            +++R+++  R W  LDI  A   L +H L L APF FTW +LRVA  +Y V GL GIT+S+HRNL+HRSFK+PKWLEY FAYCG+ ++QG+PIDWVSTHRYHHQF DS+RDPHSP EGFWFSH+ WLFD   ++E+CG   NV DL++Q +Y+FL+ T + H +             F+ WGM
Sbjct:   24 RKKRAMWE-RKWKRLDIVKAFASLFVHFLCLLAPFNFTWPALRVALIVYTVGGL-GITVSYHRNLAHRSFKVPKWLEYFFAYCGLLAIQGDPIDWVSTHRYHHQFTDSDRDPHSPNEGFWFSHLLWLFDTGYLVEKCGRRTNVEDLKRQWYYKFLQRTVLYHILTFGFLLYYFGGLSFLTWGM 204          
BLAST of FC929016 vs. ExPASy Swiss-Prot
Match: ADS2_ARATH (Delta-9 acyl-lipid desaturase 2 OS=Arabidopsis thaliana GN=ADS2 PE=2 SV=2)

HSP 1 Score: 219.164 bits (557), Expect = 2.358e-56
Identity = 100/183 (54.64%), Postives = 125/183 (68.31%), Query Frame = 2
Query:  263 KRRRSLFSGRNWNSLDISTAGVVLAMHLLALFAPFCFTWSSLRVAFGLYVVTGLLGITLSFHRNLSHRSFKLPKWLEYLFAYCGVQSLQGNPIDWVSTHRYHHQFCDSERDPHSPIEGFWFSHMSWLFDKDSVLERCGGPNNVGDLEKQPFYRFLRSTYILHPIXXXXXXXXXXXFPFIVWGM 811
            K+RR +F  R W  LD         +H LAL APF FTWS+L V F  Y + GL GIT+S+HRNL+HRSFK+PKWLEYL AYC + ++QG+PIDWVSTHRYHHQF DSERDPHSP EGFWFSH+ W++D   ++ +CG   NV DL++Q FYRFL+ T + H +             F+ WGM
Sbjct:   25 KKRRWVFWDRRWRRLDYVKFSASFTVHSLALLAPFYFTWSALWVTFLFYTIGGL-GITVSYHRNLAHRSFKVPKWLEYLLAYCALLAIQGDPIDWVSTHRYHHQFTDSERDPHSPKEGFWFSHLLWIYDSAYLVSKCGRRANVEDLKRQWFYRFLQKTVLFHILGLGFFLFYLGGMSFVTWGM 206          
BLAST of FC929016 vs. ExPASy Swiss-Prot
Match: ADSL1_ARATH (Delta-9 desaturase-like 1 protein OS=Arabidopsis thaliana GN=At1g06090 PE=2 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 6.422e-54
Identity = 99/184 (53.80%), Postives = 127/184 (69.02%), Query Frame = 2
Query:  260 VKRRRSLFSGRNWNSLDISTAGVVLAMHLLALFAPFCFTWSSLRVAFGLYVVTGLLGITLSFHRNLSHRSFKLPKWLEYLFAYCGVQSLQGNPIDWVSTHRYHHQFCDSERDPHSPIEGFWFSHMSWLFDKDSVLERCGGPNNVGDLEKQPFYRFLRSTYILHPIXXXXXXXXXXXFPFIVWGM 811
            V+  +  F  R W  +DI+ A  V A+HLL L APF + W +LR    L +VT L  IT S+HRNL+H+SFKLPKWLEY FAY  + +LQG+PIDWVSTHR+HHQF DS+RDPHSPIEGFWFSH+ W+FD   + E+CGG +NV DL++Q FYRFLR+T  LH +            P++  G+
Sbjct:   16 VRGEKRAFFFRKWTRIDIARASAVGAVHLLCLLAPFNYKWEALRFGVILAIVTSL-SITFSYHRNLTHKSFKLPKWLEYPFAYSALFALQGHPIDWVSTHRFHHQFTDSDRDPHSPIEGFWFSHVFWIFDTSYIREKCGGRDNVMDLKQQWFYRFLRNTIGLHILTFWTLVYLWGGLPYLTCGV 198          
BLAST of FC929016 vs. ExPASy Swiss-Prot
Match: ADSL3_ARATH (Delta-9 desaturase-like 3 protein OS=Arabidopsis thaliana GN=At1g06120 PE=2 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 1.095e-53
Identity = 96/184 (52.17%), Postives = 126/184 (68.48%), Query Frame = 2
Query:  260 VKRRRSLFSGRNWNSLDISTAGVVLAMHLLALFAPFCFTWSSLRVAFGLYVVTGLLGITLSFHRNLSHRSFKLPKWLEYLFAYCGVQSLQGNPIDWVSTHRYHHQFCDSERDPHSPIEGFWFSHMSWLFDKDSVLERCGGPNNVGDLEKQPFYRFLRSTYILHPIXXXXXXXXXXXFPFIVWGM 811
            V++ +  F  R W  +D+     V A+HLL L APF +TW + R A  + + T L  IT S+HRNL+HRSFKLPKWLEY FAY  + +LQG+PIDWVSTHR+HHQF DS+RDPHSPIEGFWFSH+ W+FD   + E+CGG +NV DL++Q FYRFL++T  LH +            P++ W +
Sbjct:   16 VRKEKRAFLFRKWTRVDVMRVSAVGAVHLLCLLAPFNYTWEAFRFAAMVGISTNL-SITFSYHRNLTHRSFKLPKWLEYPFAYSALFALQGHPIDWVSTHRFHHQFTDSDRDPHSPIEGFWFSHVFWIFDTSYIREKCGGRDNVMDLKQQWFYRFLQNTIGLHILTFWILVYLWGGLPYLTWSV 198          
BLAST of FC929016 vs. ExPASy Swiss-Prot
Match: ADSL2_ARATH (Delta-9 desaturase-like 2 protein OS=Arabidopsis thaliana GN=At1g06100 PE=2 SV=1)

HSP 1 Score: 208.764 bits (530), Expect = 3.187e-53
Identity = 93/182 (51.10%), Postives = 122/182 (67.03%), Query Frame = 2
Query:  260 VKRRRSLFSGRNWNSLDISTAGVVLAMHLLALFAPFCFTWSSLRVAFGLYVVTGLLGITLSFHRNLSHRSFKLPKWLEYLFAYCGVQSLQGNPIDWVSTHRYHHQFCDSERDPHSPIEGFWFSHMSWLFDKDSVLERCGGPNNVGDLEKQPFYRFLRSTYILHPIXXXXXXXXXXXFPFIVW 805
            V++ +  +  R W   D+  A  V  +HLL L APF + W + R    L ++T L  IT S+HRNL+HRSFKLPKWLEY FAY  + +LQG+P+DWVS HR+HHQF DS+RDPHSPIEGFWFSH+ W+FD D + E+CG  NNV DL++Q FYRFL+ T +LH +            P++ W
Sbjct:   16 VRKEKRAYVLRKWTQFDVGRASTVGTVHLLCLLAPFNYKWEAFRFGIILAILTNLC-ITFSYHRNLTHRSFKLPKWLEYPFAYSALLALQGDPLDWVSIHRFHHQFTDSDRDPHSPIEGFWFSHVLWIFDTDYIREKCGRRNNVMDLKQQWFYRFLKKTLVLHILAFWTLIYLWGGLPYLTW 196          
BLAST of FC929016 vs. ExPASy Swiss-Prot
Match: ADSL5_ARATH (Delta-9 desaturase-like 5 protein OS=Arabidopsis thaliana GN=At1g06360 PE=2 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 4.763e-49
Identity = 93/183 (50.82%), Postives = 118/183 (64.48%), Query Frame = 2
Query:  260 VKRRRSLFSGRNWNSLDISTAGVVLAMHLLALFAPFCFTWSSLRVAFGLYVVTGLLGITLSFHRNLSHRSFKLPKWLEYLFAYCGVQSLQGNPIDWVSTHRYHHQFCDSERDPHSPIEGFWFSHMSWLFDKDSVLERCGGPNNVGDLEKQPFYRFLRSTYILHPIXXXXXXXXXXXFPFIVWG 808
            V + +  +  R W+  DI  A  V+ +H L L APF + W +LR  F LY +T L  IT S+HRNL+HRSFKLPKWLEY  AY  V +LQG+P+DWVS HR+HHQF DS+RDPHSPIEGFWFSH+ W+ D   +  +CGG NNV DL++Q FY FLR T   H +            P++  G
Sbjct:   16 VSKEKRPYIHREWSWADIIRALTVINVHFLCLLAPFNYKWEALRFGFVLYALTSL-SITFSYHRNLAHRSFKLPKWLEYPLAYFAVFALQGDPLDWVSIHRFHHQFTDSDRDPHSPIEGFWFSHVWWICDTRYIKYKCGGRNNVMDLKQQWFYWFLRMTIGFHVLMFWTVLYLYGGLPYLTCG 197          
BLAST of FC929016 vs. ExPASy Swiss-Prot
Match: ADSL4_ARATH (Delta-9 desaturase-like 4 protein OS=Arabidopsis thaliana GN=At1g06350 PE=2 SV=2)

HSP 1 Score: 192.971 bits (489), Expect = 1.810e-48
Identity = 93/185 (50.27%), Postives = 121/185 (65.41%), Query Frame = 2
Query:  254 VLVKRRRSLFSGRNWNSLDISTAGVVLAMHLLALFAPFCFTWSSLRVAFGLYVVTGLLGITLSFHRNLSHRSFKLPKWLEYLFAYCGVQSLQGNPIDWVSTHRYHHQFCDSERDPHSPIEGFWFSHMSWLFDKDSVLERCGGPNNVGDLEKQPFYRFLRSTYILHPIXXXXXXXXXXXFPFIVWG 808
            V   ++R+ F  R W  +D+  A VV+ +H L L APF F W +LR    L+ +T  L IT SFHRNLSHRSFK+PKWLEY +AY  V +LQG+P+DWVS HR+HHQF DS+RDPHSP EG  FSH+ W+FD   +  +CGG +NV DL+KQ FY+FLR T  +H +            P++  G
Sbjct:   16 VSTMQKRAYFQ-RQWPLVDVVRASVVVIVHFLCLLAPFNFKWEALRFGLVLFALT-TLSITFSFHRNLSHRSFKIPKWLEYPWAYSAVFALQGDPMDWVSIHRFHHQFTDSDRDPHSPKEGLLFSHILWIFDTQYIKYKCGGRDNVLDLKKQWFYKFLRRTIAVHILMFWTILYLYGGLPYLTCG 198          
BLAST of FC929016 vs. ExPASy Swiss-Prot
Match: ACO1_SCHPO (Probable acyl-CoA desaturase OS=Schizosaccharomyces pombe GN=SPCC1281.06c PE=2 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 2.158e-17
Identity = 51/176 (28.98%), Postives = 88/176 (50.00%), Query Frame = 2
Query:  296 WNSLDISTAGVVLAMHLLALFAPFCFTWSSLRVAFGL--YVVTGLLGITLSFHRNLSHRSFKLPKWLEYLFAYCGVQSLQGNPIDWVSTHRYHHQFCDSERDPHSPIEGFWFSHMSWLFDKDSVLERCGGPNNVGDLEKQPFYRFLRSTYILHPIXXXXXXXXXXXFPFIVWGMVR 817
            W  L+     ++  + ++A++  F     +  + F +  Y  +GL GIT  +HR  SHR++K  K LEY  A  G  + +G+   W   HR HH++ D+++DP++  +GFW++H+ W+    +   R  G ++V DL   PF  F    ++  PI           F  ++WG  R
Sbjct:   59 WRHLNWLHCMLIFGLPMIAIYGVFTTPLQTKTLIFAIIYYAYSGL-GITAGYHRLWSHRAYKAKKPLEYFLAAGGAAAFEGSIRWWSRDHRAHHRYTDTDKDPYNVKKGFWYAHVGWMIILQN--PRRIGRSDVSDLNSDPFVMFNHRHFL--PIASFMAFIFPSLFCGLLWGDYR 229          
The following BLAST results are available for this feature:
BLAST of FC929016 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
ADS3_ARATH5.041e-8369.74Palmitoyl-monogalactosyldiacylglycerol delta-7 des... [more]
ADS32_ARATH2.976e-5952.94Probable lipid desaturase ADS3.2, chloroplastic OS... [more]
ADS1_ARATH8.105e-5755.19Delta-9 acyl-lipid desaturase 1 OS=Arabidopsis tha... [more]
ADS2_ARATH2.358e-5654.64Delta-9 acyl-lipid desaturase 2 OS=Arabidopsis tha... [more]
ADSL1_ARATH6.422e-5453.80Delta-9 desaturase-like 1 protein OS=Arabidopsis t... [more]
ADSL3_ARATH1.095e-5352.17Delta-9 desaturase-like 3 protein OS=Arabidopsis t... [more]
ADSL2_ARATH3.187e-5351.10Delta-9 desaturase-like 2 protein OS=Arabidopsis t... [more]
ADSL5_ARATH4.763e-4950.82Delta-9 desaturase-like 5 protein OS=Arabidopsis t... [more]
ADSL4_ARATH1.810e-4850.27Delta-9 desaturase-like 4 protein OS=Arabidopsis t... [more]
ACO1_SCHPO2.158e-1728.98Probable acyl-CoA desaturase OS=Schizosaccharomyce... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH1DA07RM2 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH1DA07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929016 ID=FC929016|Name=FC929016|organism=Citrus clementina|type=EST|length=844bp
AAAATCTTTCACTTTTTCACCTCTGTGTCAAGCAAGAAAAACTCAAACCG
ATAAAGTTCTGGCCTTCGGCAATTCTAACTTACAACACAAGCTAGTAAAA
ACGAGCTTTGTGTATCATGTTTATAAATATAACAAAAGAGAGTCACTAGC
AATTGTTAATGCAGCATCAATTGAATCGACAGAACCAAAGCCAGAGCCAG
AGCCAGAGCAAATTCCCGAAGTGGAAACTTATGGGAGAATTTTGTTATCT
GATGTGTTGGTGAAGAGGAGAAGAAGTTTATTTTCTGGGAGGAATTGGAA
CTCATTGGATATAAGCACAGCTGGTGTTGTTTTGGCAATGCATTTGCTTG
CTCTCTTTGCGCCATTTTGTTTCACGTGGAGTTCTCTTAGGGTTGCTTTT
GGACTTTATGTTGTGACTGGACTTCTGGGTATCACTCTTTCTTTTCACAG
AAACCTTTCTCATAGGAGTTTTAAATTACCCAAATGGCTTGAGTACTTGT
TTGCTTATTGCGGAGTTCAGTCTCTTCAGGGGAATCCAATTGATTGGGTA
AGCACACATAGGTATCATCACCAGTTTTGTGATTCCGAAAGGGATCCGCA
TAGTCCCATTGAAGGGTTTTGGTTTAGTCACATGAGTTGGCTGTTTGATA
AGGATTCTGTTCTCGAAAGGTGTGGAGGGCCAAACAATGTGGGAGATTTA
GAGAAGCAGCCTTTCTATAGATTCTTAAGAAGCACTTACATTCTCCATCC
AATTGCACTTGGAGGCTTGCTATATGCACTGGGAGGCTTTCCTTTCATTG
TGTGGGGAATGGTAAGGAAGCACTTTCCTTTTAGCTGTTCTGTT
back to top