FC929076

Overview
NameFC929076
Unique NameFC929076
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length753
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9261 contig Ccv1_Contig9261:1..753. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929076 vs. ExPASy Swiss-Prot
Match: CYB51_ARATH (Cytochrome b5 isoform 1 OS=Arabidopsis thaliana GN=At5g53560 PE=2 SV=2)

HSP 1 Score: 199.904 bits (507), Expect = 1.240e-50
Identity = 93/134 (69.40%), Postives = 106/134 (79.10%), Query Frame = 1
Query:  217 MASDPKIHQFEEVATHNKTKDCWLIISGKVYDVSSFMDDHPGGDEVLISATGKDATNDFEDVGHSDSAREMMDKYYIGDIDPSTVPRKRAYIPPQQPAYNQDKTPEFXXXXXXXXXXXXXXXXAFAVRHYTKKE 618
            M+SD K+  FEEV+ HNKTKDCWLIISGKVYDV+ FMDDHPGGDEVL+S+TGKDATNDFEDVGHSD+AR+MMDKY+IG+ID S+VP  R Y+ PQQPAYNQDKTPEF                A  VRHYTKK+
Sbjct:    1 MSSDRKVLSFEEVSKHNKTKDCWLIISGKVYDVTPFMDDHPGGDEVLLSSTGKDATNDFEDVGHSDTARDMMDKYFIGEIDSSSVPATRTYVAPQQPAYNQDKTPEFIIKILQFLVPILILGLALVVRHYTKKD 134          
BLAST of FC929076 vs. ExPASy Swiss-Prot
Match: CYB5_BRAOB (Cytochrome b5 OS=Brassica oleracea var. botrytis GN=CYB5 PE=1 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 1.790e-49
Identity = 93/134 (69.40%), Postives = 104/134 (77.61%), Query Frame = 1
Query:  217 MASDPKIHQFEEVATHNKTKDCWLIISGKVYDVSSFMDDHPGGDEVLISATGKDATNDFEDVGHSDSAREMMDKYYIGDIDPSTVPRKRAYIPPQQPAYNQDKTPEFXXXXXXXXXXXXXXXXAFAVRHYTKKE 618
            MAS+ K+  FEEV+ HNKTKDCWLIISGKVYDV+ FMDDHPGGDEVL+S+TGKDATNDFEDVGHSD+AR+MM+KYYIG+ID STVP  R Y+ P QPAYNQDKTPEF                A  VR YTKKE
Sbjct:    1 MASEKKVLGFEEVSQHNKTKDCWLIISGKVYDVTPFMDDHPGGDEVLLSSTGKDATNDFEDVGHSDTARDMMEKYYIGEIDSSTVPATRTYVAPVQPAYNQDKTPEFMIKILQFLVPILILGLALVVRQYTKKE 134          
BLAST of FC929076 vs. ExPASy Swiss-Prot
Match: CYB5_TOBAC (Cytochrome b5 OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 5.578e-43
Identity = 79/133 (59.40%), Postives = 94/133 (70.68%), Query Frame = 1
Query:  217 MASDPKIHQFEEVATHNKTKDCWLIISGKVYDVSSFMDDHPGGDEVLISATGKDATNDFEDVGHSDSAREMMDKYYIGDIDPSTVPRKRAYIPPQQPAYNQDKTPEFXXXXXXXXXXXXXXXXAFAVRHYTKK 615
            M  + K+    EV+ HN  KDCWL+ISGKVYDV+ F+DDHPGGDEVL+SATGKDAT+DFEDVGHS SAR M+D+YY+GDID +T+P K  Y PP QP YNQDKT EF                AF +R YTK+
Sbjct:    1 MGGETKVFTLAEVSQHNNAKDCWLVISGKVYDVTKFLDDHPGGDEVLLSATGKDATDDFEDVGHSSSARAMLDEYYVGDIDSATIPTKTKYTPPNQPHYNQDKTSEFVVKLLQFLVPLIILGVAFGIRFYTKQ 133          
BLAST of FC929076 vs. ExPASy Swiss-Prot
Match: CYB5_ORYSJ (Cytochrome b5 OS=Oryza sativa subsp. japonica GN=Os05g0108800 PE=2 SV=2)

HSP 1 Score: 172.555 bits (436), Expect = 2.119e-42
Identity = 78/129 (60.47%), Postives = 95/129 (73.64%), Query Frame = 1
Query:  232 KIHQFEEVATHNKTKDCWLIISGKVYDVSSFMDDHPGGDEVLISATGKDATNDFEDVGHSDSAREMMDKYYIGDIDPSTVPRKRAYIPPQQPAYNQDKTPEFXXXXXXXXXXXXXXXXAFAVRHYTKKE 618
            K++  EEVA HN   DCWLII GKVY+VS F++DHPGGD+VL+S+TGKDAT+DFEDVGHS +AR MMD+YY+GDID ST+P +  Y+PP+QP YNQDKTPEF                A A+R YTK E
Sbjct:    7 KVYTLEEVAKHNSKDDCWLIIGGKVYNVSKFLEDHPGGDDVLLSSTGKDATDDFEDVGHSTTARAMMDEYYVGDIDTSTIPARTKYVPPKQPHYNQDKTPEFIIKILQFLVPLAILGLAVAIRIYTKSE 135          
BLAST of FC929076 vs. ExPASy Swiss-Prot
Match: CYB5S_TOBAC (Cytochrome b5, seed isoform OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 8.905e-41
Identity = 77/133 (57.89%), Postives = 92/133 (69.17%), Query Frame = 1
Query:  217 MASDPKIHQFEEVATHNKTKDCWLIISGKVYDVSSFMDDHPGGDEVLISATGKDATNDFEDVGHSDSAREMMDKYYIGDIDPSTVPRKRAYIPPQQPAYNQDKTPEFXXXXXXXXXXXXXXXXAFAVRHYTKK 615
            M    K+    EV+ HN  KDCWLIISGKVY+V+ F++DHPGG EVL+SATGKDAT+DFED+GHS SAR M+D+YY+GDID ST+P K  Y PP+QP YNQDKT EF                AF V  YTK+
Sbjct:    1 MGGQSKVFTLAEVSNHNNAKDCWLIISGKVYNVTKFLEDHPGGGEVLLSATGKDATDDFEDIGHSSSARAMLDEYYVGDIDSSTIPTKVKYTPPKQPHYNQDKTTEFIVKLLQFLVPLIILGVAFGVHFYTKQ 133          
BLAST of FC929076 vs. ExPASy Swiss-Prot
Match: CYB52_ARATH (Probable cytochrome b5 isoform 2 OS=Arabidopsis thaliana GN=At2g32720 PE=1 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 1.163e-40
Identity = 73/132 (55.30%), Postives = 97/132 (73.48%), Query Frame = 1
Query:  217 MASDPKIHQFEEVATHNKTKDCWLIISGKVYDVSSFMDDHPGGDEVLISATGKDATNDFEDVGHSDSAREMMDKYYIGDIDPSTVPRKRAYIPPQQPAYNQDKTPEFXXXXXXXXXXXXXXXXAFAVRHYTK 612
            M  + KI    EV+ HN+  DCW++I+GKVY+V+ F++DHPGGD+VL+S+TGKDAT+DFEDVGHS+SAREMM++YY+G+IDP+T+P+K  Y PP+QP YNQDKT EF                A  +R YTK
Sbjct:    1 MGDEAKIFTLSEVSEHNQAHDCWIVINGKVYNVTKFLEDHPGGDDVLLSSTGKDATDDFEDVGHSESAREMMEQYYVGEIDPTTIPKKVKYTPPKQPHYNQDKTSEFIIKLLQFLVPLAILGLAVGIRIYTK 132          
BLAST of FC929076 vs. ExPASy Swiss-Prot
Match: CYB5_BOROF (Cytochrome b5 OS=Borago officinalis PE=2 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 3.741e-39
Identity = 73/127 (57.48%), Postives = 91/127 (71.65%), Query Frame = 1
Query:  232 KIHQFEEVATHNKTKDCWLIISGKVYDVSSFMDDHPGGDEVLISATGKDATNDFEDVGHSDSAREMMDKYYIGDIDPSTVPRKRAYIPPQQPAYNQDKTPEFXXXXXXXXXXXXXXXXAFAVRHYTK 612
            KI    EVA HN +KDCWLII+GKVYDV+ F++DHPGGD+VL+SATGKDAT+DFED+GHS SA+ M+D+YY+GDID S++P +  Y PP+QP YN DKT EF                A  +R YTK
Sbjct:    3 KIFTLAEVAQHNNSKDCWLIINGKVYDVTKFLEDHPGGDDVLLSATGKDATDDFEDIGHSSSAKAMLDEYYVGDIDSSSIPSQVKYTPPKQPLYNPDKTREFVIKLLQFLVPLVILAGAIGIRFYTK 129          
BLAST of FC929076 vs. ExPASy Swiss-Prot
Match: CYB5_CUSRE (Cytochrome b5 OS=Cuscuta reflexa PE=2 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 5.973e-37
Identity = 68/128 (53.12%), Postives = 89/128 (69.53%), Query Frame = 1
Query:  232 KIHQFEEVATHNKTKDCWLIISGKVYDVSSFMDDHPGGDEVLISATGKDATNDFEDVGHSDSAREMMDKYYIGDIDPSTVPRKRAYIPPQQPAYNQDKTPEFXXXXXXXXXXXXXXXXAFAVRHYTKK 615
            K++   EV+ H++  DCWL+I GKVYDV+ F+DDHPGG +VL+S+T KDAT+DFED+GHS SAR MMD+  +GDID ST+P K +Y PP+QP YNQDKTP+F                A  +R Y K+
Sbjct:    5 KVYSLAEVSEHSQPNDCWLVIGGKVYDVTKFLDDHPGGADVLLSSTAKDATDDFEDIGHSSSARAMMDEMCVGDIDSSTIPTKTSYTPPKQPLYNQDKTPQFIIKLLQFLVPLIILGVAVGIRFYKKQ 132          
BLAST of FC929076 vs. ExPASy Swiss-Prot
Match: CYB5B_PONAB (Cytochrome b5 type B OS=Pongo abelii GN=CYB5B PE=2 SV=2)

HSP 1 Score: 102.834 bits (255), Expect = 2.062e-21
Identity = 44/85 (51.76%), Postives = 62/85 (72.94%), Query Frame = 1
Query:  211 EQMASDPKIHQFEEVATHNKTKDCWLIISGKVYDVSSFMDDHPGGDEVLISATGKDATNDFEDVGHSDSAREMMDKYYIGDIDPS 465
            +++ +    ++ EEVA  N  K+ WL+I G+VYDV+ F+++HPGG+EVL+   G DA+  FEDVGHS  AREM+ +YYIGDI PS
Sbjct:   14 QEVETSVTYYRMEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPS 98          
BLAST of FC929076 vs. ExPASy Swiss-Prot
Match: CYB5B_MOUSE (Cytochrome b5 type B OS=Mus musculus GN=Cyb5b PE=1 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 2.062e-21
Identity = 44/88 (50.00%), Postives = 63/88 (71.59%), Query Frame = 1
Query:  223 SDPKI--HQFEEVATHNKTKDCWLIISGKVYDVSSFMDDHPGGDEVLISATGKDATNDFEDVGHSDSAREMMDKYYIGDIDPSTVPRK 480
            S+P +  ++ EEVA  N  ++ W++I G+VYD++ F+ +HPGG+EVL+   G DAT  FEDVGHS  AREM+ +YYIGD+ PS +  K
Sbjct:   16 SEPSVTYYRLEEVAKRNSAEETWMVIHGRVYDITRFLSEHPGGEEVLLEQAGADATESFEDVGHSPDAREMLKQYYIGDVHPSDLKPK 103          
The following BLAST results are available for this feature:
BLAST of FC929076 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 58
Match NameE-valueIdentityDescription
CYB51_ARATH1.240e-5069.40Cytochrome b5 isoform 1 OS=Arabidopsis thaliana GN... [more]
CYB5_BRAOB1.790e-4969.40Cytochrome b5 OS=Brassica oleracea var. botrytis G... [more]
CYB5_TOBAC5.578e-4359.40Cytochrome b5 OS=Nicotiana tabacum PE=2 SV=1[more]
CYB5_ORYSJ2.119e-4260.47Cytochrome b5 OS=Oryza sativa subsp. japonica GN=O... [more]
CYB5S_TOBAC8.905e-4157.89Cytochrome b5, seed isoform OS=Nicotiana tabacum P... [more]
CYB52_ARATH1.163e-4055.30Probable cytochrome b5 isoform 2 OS=Arabidopsis th... [more]
CYB5_BOROF3.741e-3957.48Cytochrome b5 OS=Borago officinalis PE=2 SV=1[more]
CYB5_CUSRE5.973e-3753.13Cytochrome b5 OS=Cuscuta reflexa PE=2 SV=1[more]
CYB5B_PONAB2.062e-2151.76Cytochrome b5 type B OS=Pongo abelii GN=CYB5B PE=2... [more]
CYB5B_MOUSE2.062e-2150.00Cytochrome b5 type B OS=Mus musculus GN=Cyb5b PE=1... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH3CB04RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH3CB04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929076 ID=FC929076|Name=FC929076|organism=Citrus clementina|type=EST|length=753bp
TGTAAGCAAGCGGATCACAGATTCCTCACTTTGTTTGATTTCAAATTCTA
CTTCTTTAGAGTTTAAACATAAAAGGGTTTCTTTATTTGCTGTTGTTTTG
ATCAAAAAGTTCCCTTTTTGGTTGGTGTTTGGGTCGATTCTACATTTTTA
CTTTATTTTTTTGTGGGGTTTTTTTGAATTTGTTGAGGTTTTGTGTTTAG
CTGCAGTAGCGAACAAATGGCCTCAGATCCAAAGATTCACCAGTTCGAAG
AGGTCGCCACGCACAACAAAACTAAGGATTGCTGGCTTATTATTTCTGGC
AAGGTGTATGATGTGTCCTCGTTCATGGATGATCACCCTGGAGGAGATGA
GGTTTTGATTTCTGCAACTGGGAAAGATGCAACAAATGACTTTGAAGATG
TGGGTCACAGTGACTCCGCTAGGGAGATGATGGACAAGTACTATATTGGT
GACATTGATCCCTCAACTGTTCCTCGGAAACGTGCATATATTCCACCGCA
GCAACCTGCTTACAATCAAGACAAGACCCCTGAGTTCATTATTAAGATTC
TACAGATTCTTGTGCCGCTCTTGATATTGGGTTTAGCCTTTGCGGTCAGA
CACTATACCAAGAAAGAGTAGGTCACAATATCAATAAAATGAGTCATCTC
CGGAATGGGAAGCTGGTGATTTGCATGAGCTTAGTTCTAGGACATTTATC
TTTTATTTACTTTCCTATGGTGTTTGGTTTTGCTGAAATTGAATAGTGGT
TCG
back to top