FC929080

Overview
NameFC929080
Unique NameFC929080
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length744
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15024 contig Ccv1_Contig15024:1..744. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929080 vs. ExPASy Swiss-Prot
Match: RL72_ARATH (60S ribosomal protein L7-2 OS=Arabidopsis thaliana GN=RPL7B PE=1 SV=1)

HSP 1 Score: 280.411 bits (716), Expect = 7.059e-75
Identity = 139/168 (82.74%), Postives = 148/168 (88.10%), Query Frame = -1
Query:  241 FYVNPEAKLLFIIRIRGINAVDPKTKKILQLLRLRQIFNGVFLKVNKAPLNMLHRVEPYVTYGYPNLKSVKELIYKRGFGKLNKQRIALTDNFIIEQAFGQHGIICMEDFIPEILTVGPHFKEANNFLWPFXXXXXXXXXXXKRNPYVEGGDAGNREDYINELIRRMN 744
            FYV+PEAKLLFIIRIRGINA+DPKTKKILQLLRLRQIFNGVFLKVNKA +NML RVEPYVTYG+PNLKSVKELIYKRG+GKLN QRIALTDN I+EQA G+HGIIC ED I EILTVGPHFKEANNFLWPF           KRN YVEGGDAGNRE++INELIRRMN
Sbjct:   75 FYVDPEAKLLFIIRIRGINAIDPKTKKILQLLRLRQIFNGVFLKVNKATMNMLRRVEPYVTYGFPNLKSVKELIYKRGYGKLNHQRIALTDNSIVEQALGKHGIICTEDLIHEILTVGPHFKEANNFLWPFQLKAPLGGLKKKRNHYVEGGDAGNRENFINELIRRMN 242          
BLAST of FC929080 vs. ExPASy Swiss-Prot
Match: RL73_ARATH (60S ribosomal protein L7-3 OS=Arabidopsis thaliana GN=RPL7C PE=2 SV=1)

HSP 1 Score: 280.026 bits (715), Expect = 9.220e-75
Identity = 137/168 (81.55%), Postives = 149/168 (88.69%), Query Frame = -1
Query:  241 FYVNPEAKLLFIIRIRGINAVDPKTKKILQLLRLRQIFNGVFLKVNKAPLNMLHRVEPYVTYGYPNLKSVKELIYKRGFGKLNKQRIALTDNFIIEQAFGQHGIICMEDFIPEILTVGPHFKEANNFLWPFXXXXXXXXXXXKRNPYVEGGDAGNREDYINELIRRMN 744
            FYV+PEAKLLFIIRIRGINA+DPKTKKILQLLRLRQIFNGVFLKVNKA +NML RVEPYVTYGYPNLKSVKELIYKRG+GKLN QRIALTDN I++QA G+HGIIC+ED I EI+TVGPHFKEANNFLWPF           KRN YVEGGDAGNRE++INEL+RRMN
Sbjct:   75 FYVDPEAKLLFIIRIRGINAIDPKTKKILQLLRLRQIFNGVFLKVNKATVNMLRRVEPYVTYGYPNLKSVKELIYKRGYGKLNHQRIALTDNSIVDQALGKHGIICVEDLIHEIMTVGPHFKEANNFLWPFQLKAPLGGLKKKRNHYVEGGDAGNRENFINELVRRMN 242          
BLAST of FC929080 vs. ExPASy Swiss-Prot
Match: RL74_ARATH (60S ribosomal protein L7-4 OS=Arabidopsis thaliana GN=RPL7D PE=2 SV=1)

HSP 1 Score: 278.1 bits (710), Expect = 3.503e-74
Identity = 136/168 (80.95%), Postives = 147/168 (87.50%), Query Frame = -1
Query:  241 FYVNPEAKLLFIIRIRGINAVDPKTKKILQLLRLRQIFNGVFLKVNKAPLNMLHRVEPYVTYGYPNLKSVKELIYKRGFGKLNKQRIALTDNFIIEQAFGQHGIICMEDFIPEILTVGPHFKEANNFLWPFXXXXXXXXXXXKRNPYVEGGDAGNREDYINELIRRMN 744
            FYV+PEAKLLFIIRIRGINA+DPKTKKILQLLRLRQIFNGVFLKVNKA +NML RVEPYVTYGYPNLKSVKELIYKRGFGKLN QR ALTDN I++Q  G+HGIIC+ED I EI+TVGPHFKEANNFLWPF           KRN YVEGGDAGNRE++INEL+RRMN
Sbjct:   77 FYVDPEAKLLFIIRIRGINAIDPKTKKILQLLRLRQIFNGVFLKVNKATINMLRRVEPYVTYGYPNLKSVKELIYKRGFGKLNHQRTALTDNSIVDQGLGKHGIICVEDLIHEIMTVGPHFKEANNFLWPFQLKAPLGGMKKKRNHYVEGGDAGNRENFINELVRRMN 244          
BLAST of FC929080 vs. ExPASy Swiss-Prot
Match: RL7_PONAB (60S ribosomal protein L7 OS=Pongo abelii GN=RPL7 PE=2 SV=1)

HSP 1 Score: 232.261 bits (591), Expect = 2.205e-60
Identity = 114/168 (67.86%), Postives = 131/168 (77.98%), Query Frame = -1
Query:  241 FYVNPEAKLLFIIRIRGINAVDPKTKKILQLLRLRQIFNGVFLKVNKAPLNMLHRVEPYVTYGYPNLKSVKELIYKRGFGKLNKQRIALTDNFIIEQAFGQHGIICMEDFIPEILTVGPHFKEANNFLWPFXXXXXXXXXXXKRNPYVEGGDAGNREDYINELIRRMN 744
            FYV  E KL F+IRIRGIN V PK +K+LQLLRLRQIFNG F+K+NKA +NML  VEPY+ +GYPNLKSV ELIYKRG+GK+NK+RIALTDN +I ++ G++GIICMED I EI TVG  FKEANNFLWPF           K   +VEGGDAGNRED IN LIRRMN
Sbjct:   80 FYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTFVKLNKASINMLRIVEPYIAWGYPNLKSVNELIYKRGYGKINKKRIALTDNALIARSLGKYGIICMEDLIHEIYTVGKRFKEANNFLWPFKLSSPRGGMKKKTTHFVEGGDAGNREDQINRLIRRMN 247          
BLAST of FC929080 vs. ExPASy Swiss-Prot
Match: RL7_MACFA (60S ribosomal protein L7 OS=Macaca fascicularis GN=RPL7 PE=2 SV=1)

HSP 1 Score: 232.261 bits (591), Expect = 2.205e-60
Identity = 114/168 (67.86%), Postives = 131/168 (77.98%), Query Frame = -1
Query:  241 FYVNPEAKLLFIIRIRGINAVDPKTKKILQLLRLRQIFNGVFLKVNKAPLNMLHRVEPYVTYGYPNLKSVKELIYKRGFGKLNKQRIALTDNFIIEQAFGQHGIICMEDFIPEILTVGPHFKEANNFLWPFXXXXXXXXXXXKRNPYVEGGDAGNREDYINELIRRMN 744
            FYV  E KL F+IRIRGIN V PK +K+LQLLRLRQIFNG F+K+NKA +NML  VEPY+ +GYPNLKSV ELIYKRG+GK+NK+RIALTDN +I ++ G++GIICMED I EI TVG  FKEANNFLWPF           K   +VEGGDAGNRED IN LIRRMN
Sbjct:   80 FYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTFVKLNKASINMLRIVEPYIAWGYPNLKSVNELIYKRGYGKINKKRIALTDNALIARSLGKYGIICMEDLIHEICTVGKRFKEANNFLWPFKLSSPRGGMKKKTTHFVEGGDAGNREDQINRLIRRMN 247          
BLAST of FC929080 vs. ExPASy Swiss-Prot
Match: RL7_HUMAN (60S ribosomal protein L7 OS=Homo sapiens GN=RPL7 PE=1 SV=1)

HSP 1 Score: 232.261 bits (591), Expect = 2.205e-60
Identity = 114/168 (67.86%), Postives = 131/168 (77.98%), Query Frame = -1
Query:  241 FYVNPEAKLLFIIRIRGINAVDPKTKKILQLLRLRQIFNGVFLKVNKAPLNMLHRVEPYVTYGYPNLKSVKELIYKRGFGKLNKQRIALTDNFIIEQAFGQHGIICMEDFIPEILTVGPHFKEANNFLWPFXXXXXXXXXXXKRNPYVEGGDAGNREDYINELIRRMN 744
            FYV  E KL F+IRIRGIN V PK +K+LQLLRLRQIFNG F+K+NKA +NML  VEPY+ +GYPNLKSV ELIYKRG+GK+NK+RIALTDN +I ++ G++GIICMED I EI TVG  FKEANNFLWPF           K   +VEGGDAGNRED IN LIRRMN
Sbjct:   81 FYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTFVKLNKASINMLRIVEPYIAWGYPNLKSVNELIYKRGYGKINKKRIALTDNALIARSLGKYGIICMEDLIHEIYTVGKRFKEANNFLWPFKLSSPRGGMKKKTTHFVEGGDAGNREDQINRLIRRMN 248          
BLAST of FC929080 vs. ExPASy Swiss-Prot
Match: RL7_BOVIN (60S ribosomal protein L7 OS=Bos taurus GN=RPL7 PE=2 SV=1)

HSP 1 Score: 232.261 bits (591), Expect = 2.205e-60
Identity = 114/168 (67.86%), Postives = 131/168 (77.98%), Query Frame = -1
Query:  241 FYVNPEAKLLFIIRIRGINAVDPKTKKILQLLRLRQIFNGVFLKVNKAPLNMLHRVEPYVTYGYPNLKSVKELIYKRGFGKLNKQRIALTDNFIIEQAFGQHGIICMEDFIPEILTVGPHFKEANNFLWPFXXXXXXXXXXXKRNPYVEGGDAGNREDYINELIRRMN 744
            FYV  E KL F+IRIRGIN V PK +K+LQLLRLRQIFNG F+K+NKA +NML  VEPY+ +GYPNLKSV ELIYKRG+GK+NK+RIALTDN +I ++ G++GIICMED I EI TVG  FKEANNFLWPF           K   +VEGGDAGNRED IN LIRRMN
Sbjct:   81 FYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTFVKLNKASINMLRIVEPYIAWGYPNLKSVNELIYKRGYGKINKKRIALTDNALIARSLGKYGIICMEDLIHEIYTVGKRFKEANNFLWPFKLSSPRGGMKKKTTHFVEGGDAGNREDQINRLIRRMN 248          
BLAST of FC929080 vs. ExPASy Swiss-Prot
Match: RL7_MOUSE (60S ribosomal protein L7 OS=Mus musculus GN=Rpl7 PE=2 SV=2)

HSP 1 Score: 231.106 bits (588), Expect = 4.911e-60
Identity = 114/168 (67.86%), Postives = 130/168 (77.38%), Query Frame = -1
Query:  241 FYVNPEAKLLFIIRIRGINAVDPKTKKILQLLRLRQIFNGVFLKVNKAPLNMLHRVEPYVTYGYPNLKSVKELIYKRGFGKLNKQRIALTDNFIIEQAFGQHGIICMEDFIPEILTVGPHFKEANNFLWPFXXXXXXXXXXXKRNPYVEGGDAGNREDYINELIRRMN 744
            FYV  E KL F+IRIRGIN V PK +K+LQLLRLRQIFNG F+K+NKA +NML  VEPY+ +GYPNLKSV ELIYKRG+GK+NK+RIALTDN +I ++ G+ GIICMED I EI TVG  FKEANNFLWPF           K   +VEGGDAGNRED IN LIRRMN
Sbjct:  103 FYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTFVKLNKASINMLRIVEPYIAWGYPNLKSVNELIYKRGYGKINKKRIALTDNSLIARSLGKFGIICMEDLIHEIYTVGKRFKEANNFLWPFKLSSPRGGMKKKTTHFVEGGDAGNREDQINRLIRRMN 270          
BLAST of FC929080 vs. ExPASy Swiss-Prot
Match: RL7_RAT (60S ribosomal protein L7 OS=Rattus norvegicus GN=Rpl7 PE=1 SV=2)

HSP 1 Score: 230.335 bits (586), Expect = 8.378e-60
Identity = 113/168 (67.26%), Postives = 130/168 (77.38%), Query Frame = -1
Query:  241 FYVNPEAKLLFIIRIRGINAVDPKTKKILQLLRLRQIFNGVFLKVNKAPLNMLHRVEPYVTYGYPNLKSVKELIYKRGFGKLNKQRIALTDNFIIEQAFGQHGIICMEDFIPEILTVGPHFKEANNFLWPFXXXXXXXXXXXKRNPYVEGGDAGNREDYINELIRRMN 744
            FYV  E KL F+IRIRGIN V PK +K+LQLLRLRQIFNG F+K+NKA +NML  VEPY+ +GYPNLKSV ELIYKRG+GK+NK+RIALTDN ++ ++ G+ GIICMED I EI TVG  FKEANNFLWPF           K   +VEGGDAGNRED IN LIRRMN
Sbjct:   93 FYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTFVKLNKASVNMLRIVEPYIAWGYPNLKSVNELIYKRGYGKINKKRIALTDNSLVARSLGKFGIICMEDLIHEIYTVGKRFKEANNFLWPFKLSSPRGGMKKKTTHFVEGGDAGNREDQINRLIRRMN 260          
BLAST of FC929080 vs. ExPASy Swiss-Prot
Match: RL7_CHICK (60S ribosomal protein L7 OS=Gallus gallus GN=RPL7 PE=2 SV=1)

HSP 1 Score: 221.861 bits (564), Expect = 2.980e-57
Identity = 110/168 (65.48%), Postives = 128/168 (76.19%), Query Frame = -1
Query:  241 FYVNPEAKLLFIIRIRGINAVDPKTKKILQLLRLRQIFNGVFLKVNKAPLNMLHRVEPYVTYGYPNLKSVKELIYKRGFGKLNKQRIALTDNFIIEQAFGQHGIICMEDFIPEILTVGPHFKEANNFLWPFXXXXXXXXXXXKRNPYVEGGDAGNREDYINELIRRMN 744
            +YV  E KL F+IRIRGIN V PK +K+LQLLRLRQIFNG F+K+NKA +NML  VEPY+ +GYPNLKSV +LIYKRG+GK+NK+RIALTDN +I +  G+ GIICMED I EI TVG +FK  NNFLWPF           K   +VEGGDAGNRED IN LIRRMN
Sbjct:   79 YYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTFVKLNKASINMLRIVEPYIAWGYPNLKSVHDLIYKRGYGKINKKRIALTDNSLIRKRLGKLGIICMEDVIHEIYTVGKNFKVVNNFLWPFKLSSPRGGMKKKTIHFVEGGDAGNREDQINRLIRRMN 246          
The following BLAST results are available for this feature:
BLAST of FC929080 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 37
Match NameE-valueIdentityDescription
RL72_ARATH7.059e-7582.7460S ribosomal protein L7-2 OS=Arabidopsis thaliana... [more]
RL73_ARATH9.220e-7581.5560S ribosomal protein L7-3 OS=Arabidopsis thaliana... [more]
RL74_ARATH3.503e-7480.9560S ribosomal protein L7-4 OS=Arabidopsis thaliana... [more]
RL7_PONAB2.205e-6067.8660S ribosomal protein L7 OS=Pongo abelii GN=RPL7 P... [more]
RL7_MACFA2.205e-6067.8660S ribosomal protein L7 OS=Macaca fascicularis GN... [more]
RL7_HUMAN2.205e-6067.8660S ribosomal protein L7 OS=Homo sapiens GN=RPL7 P... [more]
RL7_BOVIN2.205e-6067.8660S ribosomal protein L7 OS=Bos taurus GN=RPL7 PE=... [more]
RL7_MOUSE4.911e-6067.8660S ribosomal protein L7 OS=Mus musculus GN=Rpl7 P... [more]
RL7_RAT8.378e-6067.2660S ribosomal protein L7 OS=Rattus norvegicus GN=R... [more]
RL7_CHICK2.980e-5765.4860S ribosomal protein L7 OS=Gallus gallus GN=RPL7 ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH3CB09RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH3CB09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929080 ID=FC929080|Name=FC929080|organism=Citrus clementina|type=EST|length=744bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTCACATGAAAACAAAAAA
TAAAATTTGGAATGATAATCCAGTCTGAAGCCAAAATAACAACACTGTCA
CTGTTATAAAAAGTAAAAAAGTTTCTACTTAACTTCCAGGGAAAAGGCGG
GGAATAATAGGAAACACTAAAAGCCAAAATTTAAAATATTGATCACATCA
AAACTTCTTCAAAAGGGGTAGGATATTCTGCAAAAGCCTAGTTCATCCTT
CTGATGAGCTCATTGATGTAATCTTCACGGTTTCCGGCATCACCGCCTTC
AACATAGGGGTTCCTCTTCTTCTTCAGGCCACCCAAGGGGGCCTTGAGCT
TGAAGGGCCATAGGAAGTTGTTTGCCTCCTTGAAGTGAGGACCAACAGTC
AAAATCTCAGGGATGAAATCTTCCATGCAAATAATTCCATGCTGCCCAAA
AGCCTGTTCGATGATAAAATTGTCGGTCAAAGCAATCCTCTGCTTATTTA
ATTTGCCGAAACCCCTCTTGTAAATCAGTTCTTTGACACTCTTTAAATTG
GGGTACCCATATGTTACATAGGGCTCAACTCTGTGCAGCATATTGAGGGG
GGCTTTGTTCACTTTCAAAAAGACACCATTAAAAATCTGTCTCAAACGGA
GAAGCTGCAAAATTTTCTTGGTCTTTGGATCAACAGCATTGATACCGCGA
ATCCTGATAATGAACAAAAGCTTAGCTTCTGGGTTGACATAAAA
back to top