FC929089

Overview
NameFC929089
Unique NameFC929089
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length813
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15017 contig Ccv1_Contig15017:1..813. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929089 vs. ExPASy Swiss-Prot
Match: H1_MAIZE (Histone H1 OS=Zea mays PE=2 SV=2)

HSP 1 Score: 83.5741 bits (205), Expect = 1.468e-15
Identity = 41/68 (60.29%), Postives = 49/68 (72.06%), Query Frame = 1
Query:  139 HPPYSEMINEAITALKERTGSSQFAIAKFIEEKQKASLPNNFXXXXXXXXXXXXANGKLVKVKNSFKL 342
            H PY+EM++EAIT+LKERTGSS +AIAKF+E+K KA LP NF            A GKL KVKNS+KL
Sbjct:   50 HLPYAEMVSEAITSLKERTGSSSYAIAKFVEDKHKAKLPPNFRKLLNVQLKKLVAGGKLTKVKNSYKL 117          
BLAST of FC929089 vs. ExPASy Swiss-Prot
Match: H1_WHEAT (Histone H1 OS=Triticum aestivum PE=2 SV=2)

HSP 1 Score: 82.4185 bits (202), Expect = 3.271e-15
Identity = 49/100 (49.00%), Postives = 56/100 (56.00%), Query Frame = 1
Query:   43 SAHPAMAPVAAKTPKEGXXXXXXXXXXXXXRAHPPYSEMINEAITALKERTGSSQFAIAKFIEEKQKASLPNNFXXXXXXXXXXXXANGKLVKVKNSFKL 342
            +A PA AP AAK  K                AHP Y+EM++EAI ALKER+GSS  AI KFIE+K KA LP NF            A GKL KVK S+KL
Sbjct:   27 AAKPAKAPKAAKAKKSTPGPKKPRVTP----AHPSYAEMVSEAIAALKERSGSSTIAIGKFIEDKHKAHLPANFRKILLTQIKKLVAAGKLTKVKGSYKL 122          
BLAST of FC929089 vs. ExPASy Swiss-Prot
Match: H1_SOLLC (Histone H1 OS=Solanum lycopersicum PE=3 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 1.243e-14
Identity = 44/68 (64.71%), Postives = 48/68 (70.59%), Query Frame = 1
Query:  139 HPPYSEMINEAITALKERTGSSQFAIAKFIEEKQKASLPNNFXXXXXXXXXXXXANGKLVKVKNSFKL 342
            HPPY EMI +AI  LKERTGSSQ AI KFIEEKQK SLP+NF            A+ KLVKVKNS+KL
Sbjct:   56 HPPYFEMIKDAIVTLKERTGSSQHAITKFIEEKQK-SLPSNFKKLLLTQLKKFVASEKLVKVKNSYKL 122          
BLAST of FC929089 vs. ExPASy Swiss-Prot
Match: H1_PEA (Histone H1 OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 8.056e-14
Identity = 41/69 (59.42%), Postives = 48/69 (69.57%), Query Frame = 1
Query:  136 AHPPYSEMINEAITALKERTGSSQFAIAKFIEEKQKASLPNNFXXXXXXXXXXXXANGKLVKVKNSFKL 342
            +HP Y EMI +AI +LKE+ GSSQ+AIAKFIEEKQK  LP NF            A+GKL+KVK SFKL
Sbjct:   61 SHPTYEEMIKDAIVSLKEKNGSSQYAIAKFIEEKQK-QLPANFKKLLLQNLKKNVASGKLIKVKGSFKL 128          
BLAST of FC929089 vs. ExPASy Swiss-Prot
Match: H1_EUPES (Histone H1 OS=Euphorbia esula PE=2 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 1.052e-13
Identity = 45/92 (48.91%), Postives = 56/92 (60.87%), Query Frame = 1
Query:   67 VAAKTPKEGXXXXXXXXXXXXXRAHPPYSEMINEAITALKERTGSSQFAIAKFIEEKQKASLPNNFXXXXXXXXXXXXANGKLVKVKNSFKL 342
            +AAK PK                +HP + EMI++AI+ LKERTGSSQ+AI KF+E+K K  LP+NF            A+GKLVKVKNSFKL
Sbjct:   38 IAAKKPKS-----------KGTSSHPSFFEMISDAISTLKERTGSSQYAINKFVEDKHK-QLPSNFRKLLLFHLKKLVASGKLVKVKNSFKL 117          
BLAST of FC929089 vs. ExPASy Swiss-Prot
Match: H11_ARATH (Histone H1.1 OS=Arabidopsis thaliana GN=At1g06760 PE=2 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 8.907e-13
Identity = 41/69 (59.42%), Postives = 46/69 (66.67%), Query Frame = 1
Query:  136 AHPPYSEMINEAITALKERTGSSQFAIAKFIEEKQKASLPNNFXXXXXXXXXXXXANGKLVKVKNSFKL 342
            +HP Y EMI +AI  LKERTGSSQ+AI KFIEEK+K  LP  F            A+GKLVKVK SFKL
Sbjct:   61 SHPTYEEMIKDAIVTLKERTGSSQYAIQKFIEEKRK-ELPPTFRKLLLLNLKRLVASGKLVKVKASFKL 128          
BLAST of FC929089 vs. ExPASy Swiss-Prot
Match: H12_ARATH (Histone H1.2 OS=Arabidopsis thaliana GN=At2g30620 PE=1 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 5.774e-12
Identity = 40/69 (57.97%), Postives = 45/69 (65.22%), Query Frame = 1
Query:  136 AHPPYSEMINEAITALKERTGSSQFAIAKFIEEKQKASLPNNFXXXXXXXXXXXXANGKLVKVKNSFKL 342
            +HP Y EMI +AI  LKERTGSSQ+AI KFIEEK K SLP  F            A+ KLVKVK SFK+
Sbjct:   61 SHPTYEEMIKDAIVTLKERTGSSQYAIQKFIEEKHK-SLPPTFRKLLLVNLKRLVASEKLVKVKASFKI 128          
BLAST of FC929089 vs. ExPASy Swiss-Prot
Match: H1_SOLPN (Histone H1 OS=Solanum pennellii PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.680e-11
Identity = 33/68 (48.53%), Postives = 44/68 (64.71%), Query Frame = 1
Query:  139 HPPYSEMINEAITALKERTGSSQFAIAKFIEEKQKASLPNNFXXXXXXXXXXXXANGKLVKVKNSFKL 342
            HPPY +MI EA+ AL E+ GSS +A+AK++E+K K  LP NF            A GKL+K+K S+KL
Sbjct:   49 HPPYFQMIKEALLALNEKGGSSPYAVAKYMEDKHKDELPANFRKILGLQLKNSAAKGKLIKIKASYKL 116          
The following BLAST results are available for this feature:
BLAST of FC929089 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 8
Match NameE-valueIdentityDescription
H1_MAIZE1.468e-1560.29Histone H1 OS=Zea mays PE=2 SV=2[more]
H1_WHEAT3.271e-1549.00Histone H1 OS=Triticum aestivum PE=2 SV=2[more]
H1_SOLLC1.243e-1464.71Histone H1 OS=Solanum lycopersicum PE=3 SV=1[more]
H1_PEA8.056e-1459.42Histone H1 OS=Pisum sativum PE=2 SV=1[more]
H1_EUPES1.052e-1348.91Histone H1 OS=Euphorbia esula PE=2 SV=1[more]
H11_ARATH8.907e-1359.42Histone H1.1 OS=Arabidopsis thaliana GN=At1g06760 ... [more]
H12_ARATH5.774e-1257.97Histone H1.2 OS=Arabidopsis thaliana GN=At2g30620 ... [more]
H1_SOLPN1.680e-1148.53Histone H1 OS=Solanum pennellii PE=2 SV=1[more]
back to top
Properties
Property NameValue
Genbank descriptionKN0AAH1DF06RM2 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH1DF06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929089 ID=FC929089|Name=FC929089|organism=Citrus clementina|type=EST|length=813bp
CTCGTGCCGATTCGGCACGAGGAATAAAAAAATTCTTTGATCTCTGCTCA
TCCTGCAATGGCTCCCGTGGCCGCGAAGACTCCTAAGGAAGGAAAATCAA
AGAATGCAGCCTCAGCGGCAACGAAGAAATCGAGGGCCCACCCTCCTTAC
TCTGAGATGATAAACGAAGCGATAACTGCGTTGAAGGAGAGGACCGGCTC
GAGTCAATTTGCGATCGCGAAGTTTATCGAGGAGAAACAGAAGGCTAGTC
TCCCTAACAATTTCAAGAAACTGTTGCTCGTTCAATTGAAGAAGCTTGTT
GCCAACGGCAAGCTGGTCAAAGTCAAGAACTCCTTCAAGCTCCCTCCTAA
ATCGTCCTCTTCTACCGCCGCCGCTGCCGCCAAGAAGCCGAAACCTTCCT
CTACCGGCGCCACTGCCGCCAAGAAGCCGAAACCTTCCTCTACCGCTGCC
GCCGCCGCGAAGAAGCCTAAAGCTAGCTCCACTGATGCTGCGGCTAAGCA
GACGAAGTCCAAGCCAAAAGCAAAAGAAGCGGCAGTGAAGTCGATCAAGT
CTCCGGCGAAGAAGGCGGTGGTTGCAGCCAAAGTGAAGAAGCTGAAGAGC
ATAAGGTCGCCGGTTAAGAAGGCTTCGGCCAAGAAGGGAAAGAAATGAAT
CGAATGCATGGCTCTGTTTGATTTAGGGTTTAGAGTTTGTAAATTTGGGG
ATAATTTTAGGTTTGTCTTTGATTTGGATTTGTGATTCTGTTTGAACAGG
TGTGGACAGAAAATTTTAGTTTAATCAAAAAGTCTGATTCTGATCAAAAA
AAAAAAAAAAAAA
back to top