FC929092

Overview
NameFC929092
Unique NameFC929092
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length851
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig952 contig Ccv1_Contig952:43..892. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929092 vs. ExPASy Swiss-Prot
Match: INO1_CITPA (Inositol-3-phosphate synthase OS=Citrus paradisi PE=3 SV=1)

HSP 1 Score: 286.189 bits (731), Expect = 9.846e-111
Identity = 137/139 (98.56%), Postives = 138/139 (99.28%), Query Frame = 2
Query:  233 MFIENFKVESPNVKYTDNEIHSVYDYETTELVHENRNGTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVF 649
            MFIENFKVESPNVKYTD+EIHSVYDYETTELVHENRNGTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGI WATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVF
Sbjct:    1 MFIENFKVESPNVKYTDHEIHSVYDYETTELVHENRNGTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGICWATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVF 139          

HSP 2 Score: 136.346 bits (342), Expect = 9.846e-111
Identity = 66/70 (94.29%), Postives = 68/70 (97.14%), Query Frame = 3
Query:  642 LCFGGWDISDMNLADAMARARVFDIDLQKQLRPYMESMVPLPGIYDLDFIAANQGSRANNVIKGTKEEQM 851
            + FGGWDISDMNLADAMARARVFDIDLQKQLRPYMESMVPLPGIYD DFIAANQGSRANNVIKGTK+EQM
Sbjct:  137 IVFGGWDISDMNLADAMARARVFDIDLQKQLRPYMESMVPLPGIYDPDFIAANQGSRANNVIKGTKKEQM 206          
BLAST of FC929092 vs. ExPASy Swiss-Prot
Match: INO1_NICPA (Inositol-3-phosphate synthase OS=Nicotiana paniculata GN=INPS1 PE=2 SV=1)

HSP 1 Score: 272.322 bits (695), Expect = 1.192e-105
Identity = 127/139 (91.37%), Postives = 135/139 (97.12%), Query Frame = 2
Query:  233 MFIENFKVESPNVKYTDNEIHSVYDYETTELVHENRNGTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVF 649
            MFIENFKVESPNVKYT++EIHSVYDY+TTELVH+ +NGTYQW VKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKD VQQANYFGSLTQAS IRVGS+NGEEIYAPFKS+LPMVNPDD+VF
Sbjct:    1 MFIENFKVESPNVKYTESEIHSVYDYQTTELVHDEKNGTYQWTVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDKVQQANYFGSLTQASTIRVGSFNGEEIYAPFKSLLPMVNPDDVVF 139          

HSP 2 Score: 133.265 bits (334), Expect = 1.192e-105
Identity = 64/68 (94.12%), Postives = 67/68 (98.53%), Query Frame = 3
Query:  648 FGGWDISDMNLADAMARARVFDIDLQKQLRPYMESMVPLPGIYDLDFIAANQGSRANNVIKGTKEEQM 851
            FGGWDISDMNLADAMARA+VFDIDLQKQLRPYMESMVPLPGIYD DFIAANQGSRANNVIKGTK+EQ+
Sbjct:  139 FGGWDISDMNLADAMARAKVFDIDLQKQLRPYMESMVPLPGIYDPDFIAANQGSRANNVIKGTKKEQI 206          
BLAST of FC929092 vs. ExPASy Swiss-Prot
Match: INO1_TOBAC (Inositol-3-phosphate synthase OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 273.478 bits (698), Expect = 3.455e-105
Identity = 128/139 (92.09%), Postives = 135/139 (97.12%), Query Frame = 2
Query:  233 MFIENFKVESPNVKYTDNEIHSVYDYETTELVHENRNGTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVF 649
            MFIENFKVESPNVKYT++EIHSVYDY+TTELVHE +NGTYQW VKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKD VQQANYFGSLTQAS IRVGS+NGEEIYAPFKS+LPMVNPDD+VF
Sbjct:    1 MFIENFKVESPNVKYTESEIHSVYDYQTTELVHEEKNGTYQWTVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDKVQQANYFGSLTQASTIRVGSFNGEEIYAPFKSLLPMVNPDDVVF 139          

HSP 2 Score: 130.568 bits (327), Expect = 3.455e-105
Identity = 63/68 (92.65%), Postives = 66/68 (97.06%), Query Frame = 3
Query:  648 FGGWDISDMNLADAMARARVFDIDLQKQLRPYMESMVPLPGIYDLDFIAANQGSRANNVIKGTKEEQM 851
            FGGWDIS MNLADAMARA+VFDIDLQKQLRPYMESMVPLPGIYD DFIAANQGSRANNVIKGTK+EQ+
Sbjct:  139 FGGWDISGMNLADAMARAKVFDIDLQKQLRPYMESMVPLPGIYDPDFIAANQGSRANNVIKGTKKEQI 206          
BLAST of FC929092 vs. ExPASy Swiss-Prot
Match: INO1_WHEAT (Inositol-3-phosphate synthase OS=Triticum aestivum GN=MIPS PE=2 SV=1)

HSP 1 Score: 271.166 bits (692), Expect = 8.405e-104
Identity = 126/139 (90.65%), Postives = 135/139 (97.12%), Query Frame = 2
Query:  233 MFIENFKVESPNVKYTDNEIHSVYDYETTELVHENRNGTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVF 649
            MFIE+FKVESPNVKYT+NEIHSVYDYETTE+VHENRNGTYQW+VKPKTVKY+FKTD  VPKLGVMLVGWGGNNGSTLT GVIAN+EGISWATKD VQQANYFGSLTQAS+IRVGSYNGEEIYAPFKS+LPMVNPDD+VF
Sbjct:    1 MFIESFKVESPNVKYTENEIHSVYDYETTEVVHENRNGTYQWVVKPKTVKYDFKTDTRVPKLGVMLVGWGGNNGSTLTAGVIANKEGISWATKDKVQQANYFGSLTQASSIRVGSYNGEEIYAPFKSLLPMVNPDDVVF 139          

HSP 2 Score: 128.257 bits (321), Expect = 8.405e-104
Identity = 62/68 (91.18%), Postives = 65/68 (95.59%), Query Frame = 3
Query:  648 FGGWDISDMNLADAMARARVFDIDLQKQLRPYMESMVPLPGIYDLDFIAANQGSRANNVIKGTKEEQM 851
            FGGWDISDMNLADAMARARV DIDLQKQLRPYME MVPLPGIYD DFIAANQGSRAN+VIKGTK+EQ+
Sbjct:  139 FGGWDISDMNLADAMARARVLDIDLQKQLRPYMEHMVPLPGIYDPDFIAANQGSRANSVIKGTKKEQV 206          
BLAST of FC929092 vs. ExPASy Swiss-Prot
Match: INO1_SESIN (Inositol-3-phosphate synthase OS=Sesamum indicum PE=2 SV=1)

HSP 1 Score: 272.707 bits (696), Expect = 1.867e-103
Identity = 128/139 (92.09%), Postives = 136/139 (97.84%), Query Frame = 2
Query:  233 MFIENFKVESPNVKYTDNEIHSVYDYETTELVHENRNGTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVF 649
            MFIE+FKVESPNVKYT+ EIHSVY+YETTELVHE+RNGTYQWIVKPKTVKYEFKTD HVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKD VQQANYFGSLTQAS+IRVGS+NGEEIYAPFKS+LPMVNPDD+VF
Sbjct:    1 MFIESFKVESPNVKYTEGEIHSVYNYETTELVHESRNGTYQWIVKPKTVKYEFKTDTHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDKVQQANYFGSLTQASSIRVGSFNGEEIYAPFKSLLPMVNPDDVVF 139          

HSP 2 Score: 125.561 bits (314), Expect = 1.867e-103
Identity = 60/68 (88.24%), Postives = 64/68 (94.12%), Query Frame = 3
Query:  648 FGGWDISDMNLADAMARARVFDIDLQKQLRPYMESMVPLPGIYDLDFIAANQGSRANNVIKGTKEEQM 851
            FGGWDIS+MNLADAM RA+V DIDLQKQLRPYME MVPLPGIYD DFIAANQGSRANNVIKGTK+EQ+
Sbjct:  139 FGGWDISNMNLADAMGRAKVLDIDLQKQLRPYMEHMVPLPGIYDPDFIAANQGSRANNVIKGTKKEQV 206          
BLAST of FC929092 vs. ExPASy Swiss-Prot
Match: INO2_ARATH (Inositol-3-phosphate synthase isozyme 2 OS=Arabidopsis thaliana GN=At2g22240 PE=2 SV=2)

HSP 1 Score: 266.929 bits (681), Expect = 1.201e-102
Identity = 124/139 (89.21%), Postives = 135/139 (97.12%), Query Frame = 2
Query:  233 MFIENFKVESPNVKYTDNEIHSVYDYETTELVHENRNGTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVF 649
            MFIE+FKVESPNVKYT+NEI+SVYDYETTE+VHENRNGTYQW+VKPKTVKY+FKTD  VPKLGVMLVGWGGNNGSTLT GVIAN+EGISWATKD VQQANYFGSLTQAS+IRVGSYNGEEIYAPFKS+LPMVNP+D+VF
Sbjct:    1 MFIESFKVESPNVKYTENEINSVYDYETTEVVHENRNGTYQWVVKPKTVKYDFKTDTRVPKLGVMLVGWGGNNGSTLTAGVIANKEGISWATKDKVQQANYFGSLTQASSIRVGSYNGEEIYAPFKSLLPMVNPEDVVF 139          

HSP 2 Score: 128.642 bits (322), Expect = 1.201e-102
Identity = 61/68 (89.71%), Postives = 66/68 (97.06%), Query Frame = 3
Query:  648 FGGWDISDMNLADAMARARVFDIDLQKQLRPYMESMVPLPGIYDLDFIAANQGSRANNVIKGTKEEQM 851
            FGGWDISDMNLADAMARARV DIDLQKQLRPYME+M+PLPGIYD DFIAANQGSRAN+VIKGTK+EQ+
Sbjct:  139 FGGWDISDMNLADAMARARVLDIDLQKQLRPYMENMIPLPGIYDPDFIAANQGSRANSVIKGTKKEQV 206          
BLAST of FC929092 vs. ExPASy Swiss-Prot
Match: INO3_ARATH (Probable inositol-3-phosphate synthase isozyme 3 OS=Arabidopsis thaliana GN=At5g10170 PE=2 SV=1)

HSP 1 Score: 264.618 bits (675), Expect = 3.199e-100
Identity = 123/139 (88.49%), Postives = 134/139 (96.40%), Query Frame = 2
Query:  233 MFIENFKVESPNVKYTDNEIHSVYDYETTELVHENRNGTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVF 649
            MFIE+FKVESPNVKYT+NEIHSVYDY+TTELVHEN+NG +QW VKPKTVKYEFKTD HVPKLGVMLVGWGGNNGSTLT GVIANREGISWATK+ VQQANYFGSLTQAS+IRVGS+NGEEIYAPFKS+LPMVNP++IVF
Sbjct:    1 MFIESFKVESPNVKYTENEIHSVYDYQTTELVHENKNGAFQWTVKPKTVKYEFKTDTHVPKLGVMLVGWGGNNGSTLTAGVIANREGISWATKEKVQQANYFGSLTQASSIRVGSFNGEEIYAPFKSLLPMVNPEEIVF 139          

HSP 2 Score: 122.865 bits (307), Expect = 3.199e-100
Identity = 57/70 (81.43%), Postives = 66/70 (94.29%), Query Frame = 3
Query:  642 LCFGGWDISDMNLADAMARARVFDIDLQKQLRPYMESMVPLPGIYDLDFIAANQGSRANNVIKGTKEEQM 851
            + FGGWDISDMNLADAMARA+V DIDLQKQ+RP+ME MVPLPGI+D DFIAANQGSRAN+VIKGTK++Q+
Sbjct:  137 IVFGGWDISDMNLADAMARAKVLDIDLQKQMRPFMEHMVPLPGIFDPDFIAANQGSRANHVIKGTKKQQL 206          
BLAST of FC929092 vs. ExPASy Swiss-Prot
Match: INO1_BRANA (Inositol-3-phosphate synthase OS=Brassica napus PE=2 SV=2)

HSP 1 Score: 260.766 bits (665), Expect = 3.199e-100
Identity = 121/139 (87.05%), Postives = 132/139 (94.96%), Query Frame = 2
Query:  233 MFIENFKVESPNVKYTDNEIHSVYDYETTELVHENRNGTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVF 649
            MFIE+FKVESPNVKYT+NEIHSVYDYETTE+VHEN NG YQWIVKPK VKY+FKTD  VPKLGVMLVGWGGNNGSTLT GVIAN+EGISWATKD VQQANYFGSLTQAS+IRVGS+NGEE+YAPFKS++PMVNPDD+VF
Sbjct:    1 MFIESFKVESPNVKYTENEIHSVYDYETTEVVHENVNGAYQWIVKPKVVKYDFKTDTRVPKLGVMLVGWGGNNGSTLTAGVIANKEGISWATKDKVQQANYFGSLTQASSIRVGSFNGEEMYAPFKSLVPMVNPDDVVF 139          

HSP 2 Score: 126.716 bits (317), Expect = 3.199e-100
Identity = 60/68 (88.24%), Postives = 65/68 (95.59%), Query Frame = 3
Query:  648 FGGWDISDMNLADAMARARVFDIDLQKQLRPYMESMVPLPGIYDLDFIAANQGSRANNVIKGTKEEQM 851
            FGGWDISDMNLADAM RA+V DIDLQKQLRPYME++VPLPGIYD DFIAANQGSRANNVIKGTK+EQ+
Sbjct:  139 FGGWDISDMNLADAMGRAKVLDIDLQKQLRPYMENIVPLPGIYDPDFIAANQGSRANNVIKGTKKEQV 206          
BLAST of FC929092 vs. ExPASy Swiss-Prot
Match: INO1_MESCR (Inositol-3-phosphate synthase OS=Mesembryanthemum crystallinum PE=2 SV=1)

HSP 1 Score: 255.758 bits (652), Expect = 5.445e-100
Identity = 122/141 (86.52%), Postives = 132/141 (93.62%), Query Frame = 2
Query:  233 MFIENFKVESPNVKYTDNEIHSVYDYETTELVHENRN--GTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVF 649
            MFIE+FKVESPNVKYT+NEI SVY+Y+TTELVHENR   G YQWIVKPKTV+Y FKTD  VPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKD +QQANYFGSLTQAS+IRVGS+NGEEIYAPFKS+LPMVNPDD+VF
Sbjct:    1 MFIESFKVESPNVKYTENEIESVYNYDTTELVHENRKDAGGYQWIVKPKTVQYHFKTDTRVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDKIQQANYFGSLTQASSIRVGSFNGEEIYAPFKSLLPMVNPDDVVF 141          

HSP 2 Score: 130.954 bits (328), Expect = 5.445e-100
Identity = 63/68 (92.65%), Postives = 65/68 (95.59%), Query Frame = 3
Query:  648 FGGWDISDMNLADAMARARVFDIDLQKQLRPYMESMVPLPGIYDLDFIAANQGSRANNVIKGTKEEQM 851
            FGGWDISDMNLADAM RARVFDIDLQKQLRPYME MVPLPGIYD DFIAANQGSRANNVIKGTK+EQ+
Sbjct:  141 FGGWDISDMNLADAMTRARVFDIDLQKQLRPYMEHMVPLPGIYDPDFIAANQGSRANNVIKGTKKEQV 208          
BLAST of FC929092 vs. ExPASy Swiss-Prot
Match: INO1_PHAVU (Inositol-3-phosphate synthase OS=Phaseolus vulgaris PE=2 SV=1)

HSP 1 Score: 256.914 bits (655), Expect = 7.779e-99
Identity = 123/140 (87.86%), Postives = 133/140 (95.00%), Query Frame = 2
Query:  233 MFIENFKVESPNVKYTDNEIHSVYDYETTELVHENR-NGTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVF 649
            MFIE+FKVESPNVKYT+NEIHSVYDYETTE+VHE   NGTYQWIVKPKTVKY+FKTD+ VPKLGVMLVG GGNNGSTLT GVIAN+EGISWATKD VQQANYFGSLTQAS+IRVGS+NGEEIYAPFKS+LPMVNPDD+VF
Sbjct:    1 MFIESFKVESPNVKYTENEIHSVYDYETTEVVHEKTVNGTYQWIVKPKTVKYDFKTDIRVPKLGVMLVGLGGNNGSTLTAGVIANKEGISWATKDKVQQANYFGSLTQASSIRVGSFNGEEIYAPFKSLLPMVNPDDVVF 140          

HSP 2 Score: 125.946 bits (315), Expect = 7.779e-99
Identity = 60/68 (88.24%), Postives = 66/68 (97.06%), Query Frame = 3
Query:  648 FGGWDISDMNLADAMARARVFDIDLQKQLRPYMESMVPLPGIYDLDFIAANQGSRANNVIKGTKEEQM 851
            FGGWDISDMNLADAMARARV DIDLQKQLRPYME++VPLPGI+D DFIAANQGSRAN+VIKGTK+EQ+
Sbjct:  140 FGGWDISDMNLADAMARARVLDIDLQKQLRPYMENIVPLPGIFDPDFIAANQGSRANHVIKGTKKEQV 207          
The following BLAST results are available for this feature:
BLAST of FC929092 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 27
Match NameE-valueIdentityDescription
INO1_CITPA9.846e-11198.56Inositol-3-phosphate synthase OS=Citrus paradisi P... [more]
INO1_NICPA1.192e-10591.37Inositol-3-phosphate synthase OS=Nicotiana panicul... [more]
INO1_TOBAC3.455e-10592.09Inositol-3-phosphate synthase OS=Nicotiana tabacum... [more]
INO1_WHEAT8.405e-10490.65Inositol-3-phosphate synthase OS=Triticum aestivum... [more]
INO1_SESIN1.867e-10392.09Inositol-3-phosphate synthase OS=Sesamum indicum P... [more]
INO2_ARATH1.201e-10289.21Inositol-3-phosphate synthase isozyme 2 OS=Arabido... [more]
INO3_ARATH3.199e-10088.49Probable inositol-3-phosphate synthase isozyme 3 O... [more]
INO1_BRANA3.199e-10087.05Inositol-3-phosphate synthase OS=Brassica napus PE... [more]
INO1_MESCR5.445e-10086.52Inositol-3-phosphate synthase OS=Mesembryanthemum ... [more]
INO1_PHAVU7.779e-9987.86Inositol-3-phosphate synthase OS=Phaseolus vulgari... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH1DF10RM2 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH1DF10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929092 ID=FC929092|Name=FC929092|organism=Citrus clementina|type=EST|length=851bp
TAGTGTTGAGTCGAGTGGGAAGTGAGAATTGAGAAGGAGAGTCGAGTTCG
GAGACAGCAAGACGAAACAGCTCTTCTTCCAATAAATCTCAAAGCATTTG
TTTGGTTTTATTTAAAGCAATTTTCTCAGCAAACTCTTCTTCTAATAAAT
TTTAAAGCATTTGTTTGGTTTTTATTTAAAGCAATTTTCTCAGCGAAGTT
TTCAATTTTTTCTCTAAAATTTTCCTGGGAAAATGTTTATCGAAAATTTC
AAGGTTGAGAGCCCAAATGTGAAGTACACAGATAATGAGATTCACTCTGT
GTACGATTATGAAACCACTGAGCTTGTTCATGAGAACAGAAATGGCACTT
ATCAGTGGATTGTCAAGCCCAAAACTGTCAAATATGAGTTCAAAACCGAT
GTTCATGTCCCTAAACTTGGGGTTATGCTTGTGGGTTGGGGTGGAAACAA
CGGCTCAACTCTCACGGGTGGTGTTATCGCGAATCGAGAGGGAATCTCCT
GGGCCACAAAGGACACAGTGCAACAAGCCAATTATTTTGGTTCACTTACC
CAAGCATCAGCAATTAGAGTTGGGTCTTACAATGGAGAGGAGATTTATGC
TCCATTCAAGAGCATTCTCCCTATGGTGAACCCAGATGACATTGTGTTTT
GGAGGATGGGACATTAGTGACATGAACTTGGCTGATGCCATGGCCAGGGC
TAGAGTGTTTGATATTGATCTTCAAAAGCAACTTAGGCCTTACATGGAAT
CAATGGTCCCACTTCCTGGAATCTATGACCTTGATTTCATTGCTGCCAAT
CAAGGGTCCCGTGCCAACAACGTGATCAAAGGAACCAAGGAAGAACAAAT
G
back to top