FC929094

Overview
NameFC929094
Unique NameFC929094
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length707
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9445 contig Ccv1_Contig9445:1527..2233. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929094 vs. ExPASy Swiss-Prot
Match: SSG1_ANTMA (Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Antirrhinum majus GN=WAXY PE=2 SV=1)

HSP 1 Score: 218.779 bits (556), Expect = 2.306e-56
Identity = 103/135 (76.30%), Postives = 118/135 (87.41%), Query Frame = 3
Query:    9 ADFILIPSRFEPCGLIQLHAMRYGTVPIVASTGGLVDTVEEGFTGFQMGSFSVDCEAVDPVDVAAVSTTVRRALATYGTQALAEMMKNGMAQDLSWKGPAKKWEETLLNLEVAGSEPGIDGEEIAPLAKENVATP 413
            ADF+L+PSRFEPCGLIQLHAMRYGT+PI ASTGGLVDTV EGFTGF MG+F+V+C  VDP DV  ++TTV RALA YG+ A  EM++N MAQDLSWKGPAK WE+ LL+L V+GSEPG+DGEEIAPLAKENVATP
Sbjct:  474 ADFMLVPSRFEPCGLIQLHAMRYGTIPICASTGGLVDTVTEGFTGFHMGAFNVECATVDPADVQKIATTVERALAAYGSVAYKEMIQNCMAQDLSWKGPAKNWEKMLLSLGVSGSEPGVDGEEIAPLAKENVATP 608          
BLAST of FC929094 vs. ExPASy Swiss-Prot
Match: SSG1_SOLTU (Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Solanum tuberosum GN=WAXY PE=1 SV=1)

HSP 1 Score: 214.542 bits (545), Expect = 4.349e-55
Identity = 101/135 (74.81%), Postives = 117/135 (86.67%), Query Frame = 3
Query:    9 ADFILIPSRFEPCGLIQLHAMRYGTVPIVASTGGLVDTVEEGFTGFQMGSFSVDCEAVDPVDVAAVSTTVRRALATYGTQALAEMMKNGMAQDLSWKGPAKKWEETLLNLEVAGSEPGIDGEEIAPLAKENVATP 413
            ADF+L+PSRFEPCGLIQLHAMRYGTVPI ASTGGLVDTV+EG+TGF MG+F+V+C+ VDP DV  + TTV RALA YGT A AEM+KN M+++LSWK PAKKWE  LL L  +GSEPG++GEEIAPLAKENVATP
Sbjct:  473 ADFMLVPSRFEPCGLIQLHAMRYGTVPICASTGGLVDTVKEGYTGFHMGAFNVECDVVDPADVLKIVTTVARALAVYGTLAFAEMIKNCMSEELSWKEPAKKWETLLLGLGASGSEPGVEGEEIAPLAKENVATP 607          
BLAST of FC929094 vs. ExPASy Swiss-Prot
Match: SSG1_MANES (Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Manihot esculenta GN=WAXY PE=2 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 9.689e-55
Identity = 102/135 (75.56%), Postives = 116/135 (85.93%), Query Frame = 3
Query:    9 ADFILIPSRFEPCGLIQLHAMRYGTVPIVASTGGLVDTVEEGFTGFQMGSFSVDCEAVDPVDVAAVSTTVRRALATYGTQALAEMMKNGMAQDLSWKGPAKKWEETLLNLEVAGSEPGIDGEEIAPLAKENVATP 413
            ADF+L+PSRFEPCGLIQLHAMRYGTVPIVASTGGLVDTV+EG+TGFQMG+  V+C+ +D  DVAA+  TV RAL TY T AL EM+ N MAQDLSWKGPA+ WE+ LL+LEV GSEPG +GEEIAPLAKENV TP
Sbjct:  474 ADFMLVPSRFEPCGLIQLHAMRYGTVPIVASTGGLVDTVKEGYTGFQMGALHVECDKIDSADVAAIVKTVARALGTYATAALREMILNCMAQDLSWKGPARMWEKMLLDLEVTGSEPGTEGEEIAPLAKENVPTP 608          
BLAST of FC929094 vs. ExPASy Swiss-Prot
Match: SSG1_IPOBA (Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Ipomoea batatas GN=WAXY PE=2 SV=2)

HSP 1 Score: 213.386 bits (542), Expect = 9.689e-55
Identity = 104/135 (77.04%), Postives = 116/135 (85.93%), Query Frame = 3
Query:    9 ADFILIPSRFEPCGLIQLHAMRYGTVPIVASTGGLVDTVEEGFTGFQMGSFSVDCEAVDPVDVAAVSTTVRRALATYGTQALAEMMKNGMAQDLSWKGPAKKWEETLLNLEVAGSEPGIDGEEIAPLAKENVATP 413
            ADF+LIPSRFEPCGLIQLHAMRYGT  I ASTGGLVDTV+EG+TGF MG+F+VDCE VDP DV  V TTV RALA YGT A  EM+KN M+Q+LSWKGPAK WE  LL+L VAGSEPG++G+EIAPLAKENVATP
Sbjct:  474 ADFMLIPSRFEPCGLIQLHAMRYGTPCICASTGGLVDTVKEGYTGFHMGAFNVDCETVDPEDVLKVITTVGRALAMYGTLAFTEMIKNCMSQELSWKGPAKNWETVLLSLGVAGSEPGVEGDEIAPLAKENVATP 608          
BLAST of FC929094 vs. ExPASy Swiss-Prot
Match: SSG1_ARATH (Probable granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Arabidopsis thaliana GN=WAXY PE=2 SV=1)

HSP 1 Score: 207.994 bits (528), Expect = 4.071e-53
Identity = 99/135 (73.33%), Postives = 114/135 (84.44%), Query Frame = 3
Query:    9 ADFILIPSRFEPCGLIQLHAMRYGTVPIVASTGGLVDTVEEGFTGFQMGSFSVDCEAVDPVDVAAVSTTVRRALATYGTQALAEMMKNGMAQDLSWKGPAKKWEETLLNLEVAGSEPGIDGEEIAPLAKENVATP 413
            ADFI++PSRFEPCGLIQLHAMRYGTVPIVASTGGLVDTV++G+TGF +G F+V CE VDP DV A +  V RA+A YGT A+ EM+KN M QD SWKGPA+ WE+ LL+L VAGSE G +GEEIAPLAKENVATP
Sbjct:  476 ADFIIVPSRFEPCGLIQLHAMRYGTVPIVASTGGLVDTVKDGYTGFHIGRFNVKCEVVDPDDVIATAKAVTRAVAVYGTSAMQEMVKNCMDQDFSWKGPARLWEKVLLSLNVAGSEAGTEGEEIAPLAKENVATP 610          
BLAST of FC929094 vs. ExPASy Swiss-Prot
Match: SSG1_PEA (Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Pisum sativum PE=1 SV=1)

HSP 1 Score: 202.601 bits (514), Expect = 1.710e-51
Identity = 97/135 (71.85%), Postives = 114/135 (84.44%), Query Frame = 3
Query:    9 ADFILIPSRFEPCGLIQLHAMRYGTVPIVASTGGLVDTVEEGFTGFQMGSFSVDCEAVDPVDVAAVSTTVRRALATYGTQALAEMMKNGMAQDLSWKGPAKKWEETLLNLEVAGSEPGIDGEEIAPLAKENVATP 413
            ADFI+IPSRFEPCGL+QLHAM YGTVPIV+STGGLVDTV+EG+TGF  G F V+CE VDP DV  ++ TV+RAL TYGTQA+ +++ N MAQ+ SWK PAK WE+ LLNLEV G+  GIDG+EIAPLAKENVATP
Sbjct:  469 ADFIVIPSRFEPCGLVQLHAMPYGTVPIVSSTGGLVDTVKEGYTGFHAGPFDVECEDVDPDDVDKLAATVKRALKTYGTQAMKQIILNCMAQNFSWKKPAKLWEKALLNLEVTGNVAGIDGDEIAPLAKENVATP 603          
BLAST of FC929094 vs. ExPASy Swiss-Prot
Match: SSG1B_HORVU (Granule-bound starch synthase 1b, chloroplastic/amyloplastic (Fragment) OS=Hordeum vulgare PE=1 SV=1)

HSP 1 Score: 199.134 bits (505), Expect = 1.891e-50
Identity = 98/135 (72.59%), Postives = 109/135 (80.74%), Query Frame = 3
Query:    9 ADFILIPSRFEPCGLIQLHAMRYGTVPIVASTGGLVDTVEEGFTGFQMGSFSVDCEAVDPVDVAAVSTTVRRALATYGTQALAEMMKNGMAQDLSWKGPAKKWEETLLNLEVAGSEPGIDGEEIAPLAKENVATP 413
            ADFI+IPSRFEPCGLIQL  M YG VPI +STGGLVDTV EG TGF MGSF+V+ E VDP DVAAV + V RAL  Y T     M++N MAQDLSWKGPAKKWEE LL+L V GS+PGI+GEEIAPLAK+NVATP
Sbjct:  431 ADFIIIPSRFEPCGLIQLQGMSYGVVPICSSTGGLVDTVREGVTGFHMGSFNVEFETVDPTDVAAVGSNVTRALKQYRTPVFHAMVQNCMAQDLSWKGPAKKWEEALLSLGVEGSQPGIEGEEIAPLAKQNVATP 565          
BLAST of FC929094 vs. ExPASy Swiss-Prot
Match: SSG1_ORYSA (Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Oryza sativa GN=WAXY PE=3 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 9.712e-47
Identity = 92/135 (68.15%), Postives = 104/135 (77.04%), Query Frame = 3
Query:    9 ADFILIPSRFEPCGLIQLHAMRYGTVPIVASTGGLVDTVEEGFTGFQMGSFSVDCEAVDPVDVAAVSTTVRRALATYGTQALAEMMKNGMAQDLSWKGPAKKWEETLLNLEVAGSEPGIDGEEIAPLAKENVATP 413
            AD + +PSRFEPCGLIQL  MRYGT    ASTGGLVDTV EG TGF MG  SVDC+ V+P DV  V+TT++RA+   GT A  EM++N M QDLSWKGPAK WE  LL L VAGSEPG++GEEIAPLAKENVA P
Sbjct:  472 ADVLAVPSRFEPCGLIQLQGMRYGTPCACASTGGLVDTVIEGKTGFHMGRLSVDCKVVEPSDVQKVATTLKRAIKIVGTPAYNEMVRNCMNQDLSWKGPAKNWENVLLGLGVAGSEPGVEGEEIAPLAKENVAAP 606          
BLAST of FC929094 vs. ExPASy Swiss-Prot
Match: SSG1_SORBI (Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Sorghum bicolor GN=WAXY PE=2 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 2.164e-46
Identity = 91/135 (67.41%), Postives = 102/135 (75.56%), Query Frame = 3
Query:    9 ADFILIPSRFEPCGLIQLHAMRYGTVPIVASTGGLVDTVEEGFTGFQMGSFSVDCEAVDPVDVAAVSTTVRRALATYGTQALAEMMKNGMAQDLSWKGPAKKWEETLLNLEVAGSEPGIDGEEIAPLAKENVATP 413
            AD + + SRFEPCGLIQL  MRYGT    ASTGGLVDT+ EG TGF MG  SVDC  V+P DV  V+TT++RA+   GT A  EM+KN M QDLSWKGPAK WE  LL+L VAG EPGI+GEEIAPLAKENVA P
Sbjct:  474 ADLLAVTSRFEPCGLIQLQGMRYGTPCACASTGGLVDTIIEGKTGFHMGRLSVDCNVVEPADVKKVATTLKRAIKVVGTPAYEEMVKNCMIQDLSWKGPAKNWENVLLSLGVAGGEPGIEGEEIAPLAKENVAAP 608          
BLAST of FC929094 vs. ExPASy Swiss-Prot
Match: SSG1_MAIZE (Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Zea mays GN=WAXY PE=3 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 1.074e-45
Identity = 89/135 (65.93%), Postives = 102/135 (75.56%), Query Frame = 3
Query:    9 ADFILIPSRFEPCGLIQLHAMRYGTVPIVASTGGLVDTVEEGFTGFQMGSFSVDCEAVDPVDVAAVSTTVRRALATYGTQALAEMMKNGMAQDLSWKGPAKKWEETLLNLEVAGSEPGIDGEEIAPLAKENVATP 413
            AD + + SRFEPCGLIQL  MRYGT    ASTGGLVDT+ EG TGF MG  SVDC  V+P DV  V+TT++RA+   GT A  EM++N M QDLSWKGPAK WE  LL+L VAG EPG++GEEIAPLAKENVA P
Sbjct:  471 ADVLAVTSRFEPCGLIQLQGMRYGTPCACASTGGLVDTIIEGKTGFHMGRLSVDCNVVEPADVKKVATTLQRAIKVVGTPAYEEMVRNCMIQDLSWKGPAKNWENVLLSLGVAGGEPGVEGEEIAPLAKENVAAP 605          
The following BLAST results are available for this feature:
BLAST of FC929094 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 238
Match NameE-valueIdentityDescription
SSG1_ANTMA2.306e-5676.30Granule-bound starch synthase 1, chloroplastic/amy... [more]
SSG1_SOLTU4.349e-5574.81Granule-bound starch synthase 1, chloroplastic/amy... [more]
SSG1_MANES9.689e-5575.56Granule-bound starch synthase 1, chloroplastic/amy... [more]
SSG1_IPOBA9.689e-5577.04Granule-bound starch synthase 1, chloroplastic/amy... [more]
SSG1_ARATH4.071e-5373.33Probable granule-bound starch synthase 1, chloropl... [more]
SSG1_PEA1.710e-5171.85Granule-bound starch synthase 1, chloroplastic/amy... [more]
SSG1B_HORVU1.891e-5072.59Granule-bound starch synthase 1b, chloroplastic/am... [more]
SSG1_ORYSA9.712e-4768.15Granule-bound starch synthase 1, chloroplastic/amy... [more]
SSG1_SORBI2.164e-4667.41Granule-bound starch synthase 1, chloroplastic/amy... [more]
SSG1_MAIZE1.074e-4565.93Granule-bound starch synthase 1, chloroplastic/amy... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH1DF12RM2 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH1DF12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929094 ID=FC929094|Name=FC929094|organism=Citrus clementina|type=EST|length=707bp
GGCACGAGGCTGATTTTATTTTGATTCCAAGCAGATTTGAACCTTGTGGT
CTCATTCAATTACATGCCATGCGTTATGGAACCGTACCTATCGTGGCTTC
CACTGGTGGTTTGGTTGACACTGTGGAAGAAGGCTTTACAGGATTCCAGA
TGGGAAGCTTCAGTGTTGACTGTGAGGCTGTGGATCCAGTAGATGTGGCT
GCAGTGTCCACAACCGTCAGAAGAGCTCTTGCAACCTATGGTACTCAAGC
TTTGGCTGAAATGATGAAAAATGGCATGGCTCAAGATCTTTCATGGAAAG
GACCAGCTAAGAAATGGGAGGAGACCCTACTTAACCTGGAAGTTGCTGGT
AGTGAACCTGGAATTGACGGCGAAGAAATTGCTCCTCTTGCCAAGGAAAA
TGTGGCCACTCCTTGATCGAGGCTACAAAAATCTCCACTTTTATTTTGGA
CCGCAAACATGTTCCTGTAATTCTCCACAACCCAAGATATTACTTAGGAA
ATAACATAGGTTGGCAGTATATGCAGCATGCGCTATTTTCAATAATGGTT
TGGAGTTGAGACATTAGTGTTTACCTTGTATAATGAAATATTAAGTTCTG
TTTTACAGTTTTGTAAAAGGGCTCTGAGGGCTGTCGCCACTCTCCTGAAA
TGAAAAAGTTCAACTGAACAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAA
back to top