FC929261

Overview
NameFC929261
Unique NameFC929261
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length823
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig12949 contig Ccv1_Contig12949:141..963. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GMPPB_DICDI (Mannose-1-phosphate guanyltransferase beta OS=Dictyostelium discoideum GN=gmppB PE=2 SV=1)

HSP 1 Score: 323.553 bits (828), Expect = 8.592e-88
Identity = 155/224 (69.20%), Postives = 191/224 (85.27%), Query Frame = 1
Query:  151 MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGFWMDIGQPR 822
            MKALILVGGFGTRLRPLTLS PKP+VEFANK MILHQIEAL  +GV EVVLA+NY+P++M  +L+ +E KLGIKI  S ET PLGTAGPLALARD L D  GEPFFVLNSD+I ++PFA+++ FHK+HGGE +IMVTKV+EPSKYGVVV +E  G++ KFVEKP+++VGNKINAG+Y+ NP +LDRI+ +PTSIEKE+FP +A + +L+ M L GFWMD+GQP+
Sbjct:    1 MKALILVGGFGTRLRPLTLSKPKPIVEFANKAMILHQIEALCKIGVNEVVLAVNYRPQLMSQYLEPYEKKLGIKISYSHETVPLGTAGPLALARDLLND--GEPFFVLNSDIICDFPFADLLAFHKSHGGEGTIMVTKVEEPSKYGVVVYKEENGQILKFVEKPQVYVGNKINAGVYIFNPTILDRIQPKPTSIEKEIFPAMAADSQLYCMQLEGFWMDVGQPK 222          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GMPBA_XENLA (Mannose-1-phosphate guanyltransferase beta-A OS=Xenopus laevis GN=gmppb-A PE=2 SV=1)

HSP 1 Score: 310.457 bits (794), Expect = 7.527e-84
Identity = 148/224 (66.07%), Postives = 189/224 (84.38%), Query Frame = 1
Query:  151 MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGFWMDIGQPR 822
            MKALILVGG+GTRLRPLTLSVPKPLV+F NKP++LHQ+EAL   GVT V+LA++Y  +++   +KE E +LGI+I  S E EPLGTAGPLALAR+ L+ +  EPFFVLNSDVI ++PF +M+ FHK HG E +I+VTKV+EPSKYGVVV E  +G++++FVEKP++FV NKIN+G+Y+ +PAVLDRI+LRPTSIEKE+FP +A EG+L+AM L GFWMDIGQP+
Sbjct:    1 MKALILVGGYGTRLRPLTLSVPKPLVDFCNKPILLHQVEALVKAGVTHVILAVSYMSDMLEKEMKEQEKRLGIRISMSHEKEPLGTAGPLALARE-LLTENSEPFFVLNSDVICDFPFEDMVRFHKHHGKEGTIVVTKVEEPSKYGVVVYETESGQIQRFVEKPQVFVSNKINSGLYIFSPAVLDRIQLRPTSIEKEIFPAMAQEGQLYAMELQGFWMDIGQPK 223          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GMPPB_PIG (Mannose-1-phosphate guanyltransferase beta OS=Sus scrofa GN=GMPPB PE=1 SV=1)

HSP 1 Score: 310.071 bits (793), Expect = 9.830e-84
Identity = 148/224 (66.07%), Postives = 188/224 (83.93%), Query Frame = 1
Query:  151 MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGFWMDIGQPR 822
            MKALILVGG+GTRLRPLTLS+PKPLV+F NKP++LHQ+EAL + GV  V+LA++Y  +++   +K  E +LGI+I  S E EPLGTAGPLALARD L+ +T EPFFVLNSDVI ++PF  M++FH+ HG E SI+VTKV+EPSKYGVVV E  TG++ +FVEKP++FV NKINAG+Y+L+PAVL RI+L+PTSIEKE+FP +A EG+L+AM L GFWMDIGQP+
Sbjct:    1 MKALILVGGYGTRLRPLTLSIPKPLVDFCNKPILLHQVEALASAGVDHVILAVSYMSQMLEKEMKAQEQRLGIRISMSHEEEPLGTAGPLALARD-LLSETAEPFFVLNSDVICDFPFQAMVQFHRHHGQEGSILVTKVEEPSKYGVVVCEADTGRIHRFVEKPQVFVSNKINAGMYILSPAVLQRIQLQPTSIEKEIFPVMAKEGQLYAMELQGFWMDIGQPK 223          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GMPPB_HUMAN (Mannose-1-phosphate guanyltransferase beta OS=Homo sapiens GN=GMPPB PE=1 SV=2)

HSP 1 Score: 310.071 bits (793), Expect = 9.830e-84
Identity = 150/224 (66.96%), Postives = 187/224 (83.48%), Query Frame = 1
Query:  151 MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGFWMDIGQPR 822
            MKALILVGG+GTRLRPLTLS PKPLV+F NKP++LHQ+EAL A GV  V+LA++Y  +V+   +K  E +LGI+I  S E EPLGTAGPLALARD L+ +T +PFFVLNSDVI ++PF  M++FH+ HG E SI+VTKV+EPSKYGVVV E  TG++ +FVEKP++FV NKINAG+Y+L+PAVL RI+L+PTSIEKEVFP +A EG+L+AM L GFWMDIGQP+
Sbjct:    1 MKALILVGGYGTRLRPLTLSTPKPLVDFCNKPILLHQVEALAAAGVDHVILAVSYMSQVLEKEMKAQEQRLGIRISMSHEEEPLGTAGPLALARD-LLSETADPFFVLNSDVICDFPFQAMVQFHRHHGQEGSILVTKVEEPSKYGVVVCEADTGRIHRFVEKPQVFVSNKINAGMYILSPAVLQRIQLQPTSIEKEVFPIMAKEGQLYAMELQGFWMDIGQPK 223          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GMPBB_XENLA (Mannose-1-phosphate guanyltransferase beta-B OS=Xenopus laevis GN=gmppb-B PE=2 SV=1)

HSP 1 Score: 310.071 bits (793), Expect = 9.830e-84
Identity = 147/224 (65.62%), Postives = 189/224 (84.38%), Query Frame = 1
Query:  151 MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGFWMDIGQPR 822
            MKALILVGG+GTRLRPLTLSVPKPLV+F NKP++LHQ+EAL   GVT V+LA++Y  +++   +KE E +LGI+I  S E EPLGTAGPLALAR+ L+ +  EPFFVLNSDVI ++PF +M+ FHK HG E +I+VTKV+EPSKYGVV+ E  +G++++FVEKP++FV NKIN+G+Y+ +PAVLDRI+LRPTSIEKE+FP +A EG+LFA+ L GFWMDIGQP+
Sbjct:    1 MKALILVGGYGTRLRPLTLSVPKPLVDFCNKPILLHQVEALVKAGVTHVILAVSYMSDMLEKEMKEQEKRLGIRISMSHEKEPLGTAGPLALARE-LLTENSEPFFVLNSDVICDFPFEDMVRFHKHHGKEGTIVVTKVEEPSKYGVVIYEAESGRIQRFVEKPQVFVSNKINSGLYIFSPAVLDRIQLRPTSIEKEIFPVMAQEGQLFALELQGFWMDIGQPK 223          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GMPPB_XENTR (Mannose-1-phosphate guanyltransferase beta OS=Xenopus tropicalis GN=gmppb PE=2 SV=1)

HSP 1 Score: 309.686 bits (792), Expect = 1.284e-83
Identity = 148/224 (66.07%), Postives = 188/224 (83.93%), Query Frame = 1
Query:  151 MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGFWMDIGQPR 822
            MKALILVGG+GTRLRPLTLSVPKPLV+F NKP++LHQ+EAL   GV  V+LA++Y  +++   +KE E +LGI+I  S E EPLGTAGPLALAR+ L+ +  +PFFVLNSDVI ++PF EM+ FHK HG E +I+VTKV+EPSKYGVVV E  +G++++FVEKP++FV NKIN+G+Y+ +PAVLDRI+LRPTSIEKE+FP +A EG+LFAM L GFWMDIGQP+
Sbjct:    1 MKALILVGGYGTRLRPLTLSVPKPLVDFCNKPILLHQVEALVKAGVNHVILAVSYMSDMLEKEMKEQEKRLGIRISMSHEKEPLGTAGPLALARE-LLTENSDPFFVLNSDVICDFPFEEMVRFHKHHGKEGTIVVTKVEEPSKYGVVVYEAESGQIQRFVEKPQVFVSNKINSGLYIFSPAVLDRIQLRPTSIEKEIFPAMAQEGQLFAMELQGFWMDIGQPK 223          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GMPPB_MOUSE (Mannose-1-phosphate guanyltransferase beta OS=Mus musculus GN=Gmppb PE=2 SV=1)

HSP 1 Score: 309.301 bits (791), Expect = 1.677e-83
Identity = 148/224 (66.07%), Postives = 187/224 (83.48%), Query Frame = 1
Query:  151 MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGFWMDIGQPR 822
            MKALILVGG+GTRLRPLTLS PKPLV+F NKP++LHQ+EAL A GV  V+LA++Y  +++   +K  E +LGI+I  S E EPLGTAGPLALARD L+ +T +PFFVLNSDVI ++PF  M++FH+ HG E SI+VTKV+EPSKYGVVV E  TG++ +FVEKP++FV NKINAG+Y+L+PAVL RI+L+PTSIEKE+FP +A EG+L+AM L GFWMDIGQP+
Sbjct:    1 MKALILVGGYGTRLRPLTLSTPKPLVDFCNKPILLHQVEALAAAGVDHVILAVSYMSQMLEKEMKAQEQRLGIRISMSHEEEPLGTAGPLALARD-LLSETADPFFVLNSDVICDFPFQAMVQFHRHHGQEGSILVTKVEEPSKYGVVVCEADTGRIHRFVEKPQVFVSNKINAGMYILSPAVLQRIQLKPTSIEKEIFPVMAKEGQLYAMELQGFWMDIGQPK 223          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GMPPB_BOVIN (Mannose-1-phosphate guanyltransferase beta OS=Bos taurus GN=GMPPB PE=2 SV=1)

HSP 1 Score: 308.916 bits (790), Expect = 2.190e-83
Identity = 149/224 (66.52%), Postives = 187/224 (83.48%), Query Frame = 1
Query:  151 MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGFWMDIGQPR 822
            MKALILVGG+GTRLRPLTLS+PKPL +F NKP++LHQ+EAL A GV  V+LA++Y  +V+   +K  E KLGI+I  S E EPLGTAGPLALARD L+ +T +PFFVLNSDVI ++PF  M++FH+ HG E SI+VTKV+EPSKYGVVV E  TG+V +FVEKP++FV NKINAG+Y+L+P+VL RI+L+PTSIEKE+FP +A EG+L+AM L GFWMDIGQP+
Sbjct:    1 MKALILVGGYGTRLRPLTLSIPKPLADFCNKPILLHQVEALAAAGVDHVILAVSYMSQVLEKEMKAQEQKLGIRISMSHEEEPLGTAGPLALARD-LLCETADPFFVLNSDVICDFPFEAMVQFHRHHGQEGSILVTKVEEPSKYGVVVCEADTGRVHRFVEKPQVFVSNKINAGVYILSPSVLRRIQLQPTSIEKEIFPVMAKEGQLYAMELQGFWMDIGQPK 223          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: MPG1_YARLI (Mannose-1-phosphate guanyltransferase OS=Yarrowia lipolytica GN=MPG1 PE=3 SV=1)

HSP 1 Score: 303.908 bits (777), Expect = 7.045e-82
Identity = 147/225 (65.33%), Postives = 185/225 (82.22%), Query Frame = 1
Query:  151 MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLI-DDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGFWMDIGQPR 822
            MK LILVGG+GTRLRPLTL++PKPLVEF NKPMILHQ+E+L A GV ++VLA+NY+PEVM+  LK++E K G+ I  S ETEPLGTAGPL LA + L  DDT  PFFVLNSDVI +YPFAE+ EFHK +  EA+I+ TKV+EPSKYGV+V ++ T K+++FVEKP  FVGN+INAGIY+LNP+V+D I+LRPTSIEKE FP++A    L++  L G+WMD+GQP+
Sbjct:    1 MKGLILVGGYGTRLRPLTLTLPKPLVEFGNKPMILHQVESLAAAGVKDIVLAVNYRPEVMIETLKKYEEKYGVNITFSVETEPLGTAGPLKLAEEILCKDDT--PFFVLNSDVICDYPFAELAEFHKKNNAEATIVATKVEEPSKYGVIVHKQGTSKIDRFVEKPVEFVGNRINAGIYILNPSVVDLIDLRPTSIEKETFPQLAARESLYSFDLEGYWMDVGQPK 223          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: MPG12_CANGA (Mannose-1-phosphate guanyltransferase 2 OS=Candida glabrata GN=MPG1 PE=3 SV=1)

HSP 1 Score: 303.523 bits (776), Expect = 9.201e-82
Identity = 147/225 (65.33%), Postives = 182/225 (80.89%), Query Frame = 1
Query:  151 MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVTEEST-GKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGFWMDIGQPR 822
            MK LILVGG+GTRLRPLTLSVPKPLVEF N+PMILHQIEAL   GVT++VLA+NY+PEVM++ LK++E + G+ I  S ETEPLGTAGPL LA +K++     PFFVLNSDVI EYPF E+ EFHK+HGG+ +I+ TKVDEPSKYGV+V +  T   +++FVEKPK FVGN+INAG+Y+LNP V+D IE++PTSIE E FPK+  E  L+   L GFWMD+GQP+
Sbjct:    1 MKGLILVGGYGTRLRPLTLSVPKPLVEFCNRPMILHQIEALAEAGVTDIVLAVNYRPEVMVDTLKKYEKEYGVNITFSVETEPLGTAGPLKLA-EKILKKDNSPFFVLNSDVICEYPFKELAEFHKSHGGKGTIVATKVDEPSKYGVIVHDLGTPNLIDRFVEKPKEFVGNRINAGLYILNPEVIDLIEMKPTSIETETFPKLVNEKSLYTFDLEGFWMDVGQPK 224          
The following BLAST results are available for this feature:
BLAST of FC929261 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 124
Match NameE-valueIdentityDescription
GMPPB_DICDI8.592e-8869.20Mannose-1-phosphate guanyltransferase beta OS=Dict... [more]
GMPBA_XENLA7.527e-8466.07Mannose-1-phosphate guanyltransferase beta-A OS=Xe... [more]
GMPPB_PIG9.830e-8466.07Mannose-1-phosphate guanyltransferase beta OS=Sus ... [more]
GMPPB_HUMAN9.830e-8466.96Mannose-1-phosphate guanyltransferase beta OS=Homo... [more]
GMPBB_XENLA9.830e-8465.63Mannose-1-phosphate guanyltransferase beta-B OS=Xe... [more]
GMPPB_XENTR1.284e-8366.07Mannose-1-phosphate guanyltransferase beta OS=Xeno... [more]
GMPPB_MOUSE1.677e-8366.07Mannose-1-phosphate guanyltransferase beta OS=Mus ... [more]
GMPPB_BOVIN2.190e-8366.52Mannose-1-phosphate guanyltransferase beta OS=Bos ... [more]
MPG1_YARLI7.045e-8265.33Mannose-1-phosphate guanyltransferase OS=Yarrowia ... [more]
MPG12_CANGA9.201e-8265.33Mannose-1-phosphate guanyltransferase 2 OS=Candida... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH3DC11RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH3DC11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929261 ID=FC929261|Name=FC929261|organism=Citrus clementina|type=EST|length=823bp
GCAAAGCAAAAGCGAAGCGCGCGAAGCTCGCCTCATCCGTTGACTGAGCT
GTCGGTCCCGAGTCACGACTCGCGACTCTTGTTTTTGAACTCAGTTGTTT
GCCGTTCGGATCCGGTCTTAATTAAAGGATAAAGCAGGCTCCGTATCACA
ATGAAGGCACTTATTCTTGTTGGAGGGTTCGGAACACGGTTGAGGCCGTT
GACGCTTAGTGTCCCTAAGCCACTTGTTGAATTTGCTAACAAACCCATGA
TCCTGCATCAGATAGAGGCCCTTAAGGCAGTTGGAGTGACTGAAGTAGTT
TTGGCTATTAACTACCAGCCAGAGGTGATGTTGAACTTTTTGAAGGAATT
TGAAGCAAAGCTTGGGATCAAGATCATCTGCTCACAAGAGACTGAGCCAC
TGGGCACTGCTGGTCCTCTGGCTCTGGCTAGAGACAAATTGATTGACGAT
ACTGGTGAGCCATTTTTCGTCCTTAACAGTGATGTTATTAGTGAGTACCC
ATTTGCAGAAATGATTGAATTCCACAAAGCACATGGAGGAGAGGCCTCCA
TCATGGTAACCAAGGTGGATGAGCCATCAAAATATGGTGTGGTGGTTACG
GAAGAGTCTACTGGAAAAGTTGAGAAATTCGTTGAGAAACCTAAATTATT
TGTTGGTAACAAAATTAATGCTGGAATTTATCTTTTGAACCCTGCGGTTC
TTGATCGCATTGAGCTGAGGCCCACCTCCATTGAGAAAGAGGTCTTTCCA
AAAATTGCTTTAGAAGGAAAGCTCTTCGCGATGGTTCTTCCAGGTTTCTG
GATGGACATTGGACAGCCGAGGG
back to top