FC929266

Overview
NameFC929266
Unique NameFC929266
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length793
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9285 contig Ccv1_Contig9285:2..794. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929266 vs. ExPASy Swiss-Prot
Match: Y5344_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g53440 OS=Arabidopsis thaliana GN=At1g53440 PE=1 SV=2)

HSP 1 Score: 344.739 bits (883), Expect = 3.352e-94
Identity = 180/263 (68.44%), Postives = 206/263 (78.33%), Query Frame = 3
Query:    3 EFLYEIAMISCLQHPNLVKIHGCCVEGDQLLLVYEYMENNSLAHALFGGENSQLKLNWPVRQKICLGIARGLAFLHEESRFKIVHRDIKATNVLLDRDLNPKISDFGLAKLDEEEKTHISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVSGKNNMSYVPDSNCTCPLDWAFHLHRSGTLMELVDPRLGSEFNKVEAERMIKIALLCTNASPSLRPTMSEVVSMLEGSSNI--PDVIPEAG-GLSEDLRFKTLREH 782
            EF+ EI MIS LQHPNLVK++GCC+EG +LLLVYEY+ENNSLA ALFG E  +L L+W  R K+C+GIA+GLA+LHEESR KIVHRDIKATNVLLD  LN KISDFGLAKLDEEE THISTR+AGTIGYMAPEYA+ GYLT KADVYSFGVV LEIVSGK+N +Y P       LDWA+ L   G+L+ELVDP LG+ F+K EA RM+ IALLCTN SP+LRP MS VVSML+G   +  P V  EA    S  +RFK L EH
Sbjct:  707 EFVTEIGMISALQHPNLVKLYGCCIEGKELLLVYEYLENNSLARALFGTEKQRLHLDWSTRNKVCIGIAKGLAYLHEESRLKIVHRDIKATNVLLDLSLNAKISDFGLAKLDEEENTHISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVCLEIVSGKSNTNYRPKEEFIYLLDWAYVLQEQGSLLELVDPDLGTSFSKKEAMRMLNIALLCTNPSPTLRPPMSSVVSMLQGKIKVQPPLVKREADPSGSAAMRFKAL-EH 968          
BLAST of FC929266 vs. ExPASy Swiss-Prot
Match: Y5343_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g53430 OS=Arabidopsis thaliana GN=At1g53430 PE=1 SV=1)

HSP 1 Score: 342.043 bits (876), Expect = 2.173e-93
Identity = 177/260 (68.08%), Postives = 204/260 (78.46%), Query Frame = 3
Query:    3 EFLYEIAMISCLQHPNLVKIHGCCVEGDQLLLVYEYMENNSLAHALFGGENSQLKLNWPVRQKICLGIARGLAFLHEESRFKIVHRDIKATNVLLDRDLNPKISDFGLAKLDEEEKTHISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVSGKNNMSYVPDSNCTCPLDWAFHLHRSGTLMELVDPRLGSEFNKVEAERMIKIALLCTNASPSLRPTMSEVVSMLEGSSNI--PDVIPEAG-GLSEDLRFKTL 773
            EF+ EI MIS LQHPNLVK++GCC+EG +LLLVYEY+ENNSLA ALFG E  +L L+W  R KIC+GIA+GLA+LHEESR KIVHRDIKATNVLLD  LN KISDFGLAKL+++E THISTR+AGTIGYMAPEYA+ GYLT KADVYSFGVV LEIVSGK+N +Y P       LDWA+ L   G+L+ELVDP LG+ F+K EA RM+ IALLCTN SP+LRP MS VVSMLEG   +  P V  EA    S  +RFK L
Sbjct:  709 EFVTEIGMISALQHPNLVKLYGCCIEGKELLLVYEYLENNSLARALFGTEKQRLHLDWSTRNKICIGIAKGLAYLHEESRLKIVHRDIKATNVLLDLSLNAKISDFGLAKLNDDENTHISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVCLEIVSGKSNTNYRPKEEFVYLLDWAYVLQEQGSLLELVDPDLGTSFSKKEAMRMLNIALLCTNPSPTLRPPMSSVVSMLEGKIKVQPPLVKREADPSGSAAMRFKAL 968          
BLAST of FC929266 vs. ExPASy Swiss-Prot
Match: Y1765_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g07650 OS=Arabidopsis thaliana GN=At1g07650 PE=1 SV=1)

HSP 1 Score: 339.347 bits (869), Expect = 1.408e-92
Identity = 167/261 (63.98%), Postives = 213/261 (81.61%), Query Frame = 3
Query:    3 EFLYEIAMISCLQHPNLVKIHGCCVEGDQLLLVYEYMENNSLAHALFG-GENSQLKLNWPVRQKICLGIARGLAFLHEESRFKIVHRDIKATNVLLDRDLNPKISDFGLAKLDEEEKTHISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVSGKNNMSYVPDSNCTCPLDWAFHLHRSGTLMELVDPRLGSEFNKVEAERMIKIALLCTNASPSLRPTMSEVVSMLEGSSNIPDVIPEAGGLSEDLRFKTLREH 782
            EF+ EI MIS LQHPNLVK++GCCVEG+QL+LVYEY+ENN L+ ALFG  E+S+LKL+W  R+KI LGIA+GL FLHEESR KIVHRDIKA+NVLLD+DLN KISDFGLAKL+++  THISTR+AGTIGYMAPEYA+ GYLT KADVYSFGVVALEIVSGK+N ++ P  +    LDWA+ L   G+L+ELVDP L S++++ EA  M+ +AL+CTNASP+LRPTMS+VVS++EG + + +++ +    + + + K LR H
Sbjct:  718 EFVNEIGMISALQHPNLVKLYGCCVEGNQLILVYEYLENNCLSRALFGKDESSRLKLDWSTRKKIFLGIAKGLTFLHEESRIKIVHRDIKASNVLLDKDLNAKISDFGLAKLNDDGNTHISTRIAGTIGYMAPEYAMRGYLTEKADVYSFGVVALEIVSGKSNTNFRPTEDFVYLLDWAYVLQERGSLLELVDPTLASDYSEEEAMLMLNVALMCTNASPTLRPTMSQVVSLIEGKTAMQELLSDPSFSTVNPKLKALRNH 978          
BLAST of FC929266 vs. ExPASy Swiss-Prot
Match: RKF1_ARATH (Probable LRR receptor-like serine/threonine-protein kinase RFK1 OS=Arabidopsis thaliana GN=RKF1 PE=1 SV=1)

HSP 1 Score: 334.339 bits (856), Expect = 4.531e-91
Identity = 165/259 (63.71%), Postives = 203/259 (78.38%), Query Frame = 3
Query:    3 EFLYEIAMISCLQHPNLVKIHGCCVEGDQLLLVYEYMENNSLAHALFGGENSQLKLNWPVRQKICLGIARGLAFLHEESRFKIVHRDIKATNVLLDRDLNPKISDFGLAKLDEEEKTHISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVSGKNNMSYVPDSNCTCPLDWAFHLHRSGTLMELVDPRLGSEFNKVEAERMIKIALLCTNASPSLRPTMSEVVSMLEGSSNIPDVIPEAGGLSEDLRFKTLRE 779
            EFL EI  ISCLQHPNLVK+HG CVE  QLLL YEYMENNSL+ ALF  ++ Q+ ++WP R KIC GIA+GLAFLHEES  K VHRDIKATN+LLD+DL PKISDFGLA+LDEEEKTHIST+VAGTIGYMAPEYALWGYLT+KADVYSFGV+ LEIV+G  N +++   +  C L++A     SG LM++VD RL  E ++ EAE +IK+AL+C++ASP+ RP MSEVV+MLEG   +P+  P     + D+RFK  ++
Sbjct:  721 EFLNEIGAISCLQHPNLVKLHGFCVERAQLLLAYEYMENNSLSSALFSPKHKQIPMDWPTRFKICCGIAKGLAFLHEESPLKFVHRDIKATNILLDKDLTPKISDFGLARLDEEEKTHISTKVAGTIGYMAPEYALWGYLTFKADVYSFGVLVLEIVAGITNSNFMGAGDSVCLLEFANECVESGHLMQVVDERLRPEVDRKEAEAVIKVALVCSSASPTDRPLMSEVVAMLEGLYPVPESTPGVSRNAGDIRFKAFKD 979          
BLAST of FC929266 vs. ExPASy Swiss-Prot
Match: Y1534_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g53420 OS=Arabidopsis thaliana GN=At1g53420 PE=2 SV=2)

HSP 1 Score: 332.798 bits (852), Expect = 1.318e-90
Identity = 162/238 (68.07%), Postives = 194/238 (81.51%), Query Frame = 3
Query:    3 EFLYEIAMISCLQHPNLVKIHGCCVEGDQLLLVYEYMENNSLAHALFGGENSQLKLNWPVRQKICLGIARGLAFLHEESRFKIVHRDIKATNVLLDRDLNPKISDFGLAKLDEEEKTHISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVSGKNNMSYVPDSNCTCPLDWAFHLHRSGTLMELVDPRLGSEFNKVEAERMIKIALLCTNASPSLRPTMSEVVSMLEGSSNI 716
            EFL EI MIS L HPNLVK++GCCVEG QLLLVYE++ENNSLA ALFG + +QL+L+WP R+KIC+G+ARGLA+LHEESR KIVHRDIKATNVLLD+ LNPKISDFGLAKLDEE+ THISTR+AGT GYMAPEYA+ G+LT KADVYSFG+VALEIV G++N      +N    +DW   L     L+ELVDPRLGSE+N+ EA  MI+IA++CT++ P  RP+MSEVV MLEG   +
Sbjct:  664 EFLNEIGMISALHHPNLVKLYGCCVEGGQLLLVYEFVENNSLARALFGPQETQLRLDWPTRRKICIGVARGLAYLHEESRLKIVHRDIKATNVLLDKQLNPKISDFGLAKLDEEDSTHISTRIAGTFGYMAPEYAMRGHLTDKADVYSFGIVALEIVHGRSNKIERSKNNTFYLIDWVEVLREKNNLLELVDPRLGSEYNREEAMTMIQIAIMCTSSEPCERPSMSEVVKMLEGKKMV 901          
BLAST of FC929266 vs. ExPASy Swiss-Prot
Match: Y5614_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g56140 OS=Arabidopsis thaliana GN=At1g56140 PE=1 SV=2)

HSP 1 Score: 281.182 bits (718), Expect = 4.552e-75
Identity = 146/254 (57.48%), Postives = 187/254 (73.62%), Query Frame = 3
Query:    3 EFLYEIAMISCLQHPNLVKIHGCCVEGDQLLLVYEYMENNSLAHALFGGENSQLKLNWPVRQKICLGIARGLAFLHEESRFKIVHRDIKATNVLLDRDLNPKISDFGLAKLDEEEKTHISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVSGKNNMSYVPDSNCTCPLDWAFHLHRSGTLMELVDPRLGSEFNKVEAERMIKIALLCTNASPSLRPTMSEVVSMLEGSSNIPDVIPEAGGLSEDLRF 764
            +F+ EI  IS +QH NLVK++GCC EG+  LLVYEY+ N SL  ALFG +   L L+W  R +ICLG+ARGL +LHEE+R +IVHRD+KA+N+LLD  L PK+SDFGLAKL +++KTHISTRVAGTIGY+APEYA+ G+LT K DVY+FGVVALE+VSG+ N     +      L+WA++LH  G  +EL+D +L +EFN  E +RMI IALLCT  S +LRP MS VV+ML G   + DV  + G L+ D RF
Sbjct:  733 QFVAEIVAISAVQHRNLVKLYGCCYEGEHRLLVYEYLPNGSLDQALFGEKT--LHLDWSTRYEICLGVARGLVYLHEEARLRIVHRDVKASNILLDSKLVPKVSDFGLAKLYDDKKTHISTRVAGTIGYLAPEYAMRGHLTEKTDVYAFGVVALELVSGRPNSDENLEDEKRYLLEWAWNLHEKGREVELIDHQL-TEFNMEEGKRMIGIALLCTQTSHALRPPMSRVVAMLSGDVEVSDVTSKPGYLT-DWRF 982          
BLAST of FC929266 vs. ExPASy Swiss-Prot
Match: Y1561_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g56130 OS=Arabidopsis thaliana GN=At1g56130 PE=1 SV=2)

HSP 1 Score: 271.937 bits (694), Expect = 2.761e-72
Identity = 143/254 (56.30%), Postives = 185/254 (72.83%), Query Frame = 3
Query:    3 EFLYEIAMISCLQHPNLVKIHGCCVEGDQLLLVYEYMENNSLAHALFGGENSQLKLNWPVRQKICLGIARGLAFLHEESRFKIVHRDIKATNVLLDRDLNPKISDFGLAKLDEEEKTHISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVSGKNNMSYVPDSNCTCPLDWAFHLHRSGTLMELVDPRLGSEFNKVEAERMIKIALLCTNASPSLRPTMSEVVSMLEGSSNIPDVIPEAGGLSEDLRF 764
            +F+ EI  IS + H NLVK++GCC EG+  +LVYEY+ N SL  ALFG +   L L+W  R +ICLG+ARGL +LHEE+  +IVHRD+KA+N+LLD  L P+ISDFGLAKL +++KTHISTRVAGTIGY+APEYA+ G+LT K DVY+FGVVALE+VSG+ N     +      L+WA++LH     +EL+D +L ++FN  EA+RMI IALLCT  S +LRP MS VV+ML G   I DV  + G +S D RF
Sbjct:  734 QFVAEIVAISSVLHRNLVKLYGCCFEGEHRMLVYEYLPNGSLDQALFGDKT--LHLDWSTRYEICLGVARGLVYLHEEASVRIVHRDVKASNILLDSRLVPQISDFGLAKLYDDKKTHISTRVAGTIGYLAPEYAMRGHLTEKTDVYAFGVVALELVSGRPNSDENLEEEKKYLLEWAWNLHEKSRDIELIDDKL-TDFNMEEAKRMIGIALLCTQTSHALRPPMSRVVAMLSGDVEIGDVTSKPGYVS-DWRF 983          
BLAST of FC929266 vs. ExPASy Swiss-Prot
Match: CRK3_ARATH (Cysteine-rich receptor-like protein kinase 3 OS=Arabidopsis thaliana GN=CRK3 PE=2 SV=1)

HSP 1 Score: 241.891 bits (616), Expect = 3.060e-63
Identity = 123/237 (51.90%), Postives = 165/237 (69.62%), Query Frame = 3
Query:    6 FLYEIAMISCLQHPNLVKIHGCCVEGDQLLLVYEYMENNSLAHALFGGENSQLKLNWPVRQKICLGIARGLAFLHEESRFKIVHRDIKATNVLLDRDLNPKISDFGLAKLDEEEKTHISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVSGKNNMSYVPDSNCTCPLDWAFHLHRSGTLMELVDPRLGSEFNKVEAERMIKIALLCTNASPSLRPTMSEVVSMLEGSSNI 716
            F  E+ +IS + H NLVK+ GC + G + LLVYEY+ N SL   LF  ++ Q  LNW  R KI LG A G+A+LHEES  +I+HRDIK +N+LL+ D  P+I+DFGLA+L  E+KTHIST +AGT+GYMAPEY + G LT KADVYSFGV+ +E+++GK N ++V D+       W+  L+R+  + E VDP LG  FNK+EA R+++I LLC  A+   RP MS VV M++GS  I
Sbjct:  364 FFNEVNLISQVDHKNLVKLLGCSITGPESLLVYEYIANQSLHDYLFVRKDVQ-PLNWAKRFKIILGTAEGMAYLHEESNLRIIHRDIKLSNILLEDDFTPRIADFGLARLFPEDKTHISTAIAGTLGYMAPEYVVRGKLTEKADVYSFGVLMIEVITGKRNNAFVQDAGSILQSVWS--LYRTSNVEEAVDPILGDNFNKIEASRLLQIGLLCVQAAFDQRPAMSVVVKMMKGSLEI 597          
BLAST of FC929266 vs. ExPASy Swiss-Prot
Match: CRK42_ARATH (Cysteine-rich receptor-like protein kinase 42 OS=Arabidopsis thaliana GN=CRK42 PE=2 SV=1)

HSP 1 Score: 226.483 bits (576), Expect = 1.330e-58
Identity = 122/237 (51.48%), Postives = 160/237 (67.51%), Query Frame = 3
Query:    3 EFLYEIAMISCLQHPNLVKIHGCCVEGDQLLLVYEYMENNSLAHALFGGENSQLKLNWPVRQKICLGIARGLAFLHEESRFKIVHRDIKATNVLLDRDLNPKISDFGLAKLDEEEKTHISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVSGKNNMSYVPDSNCTCPLDWAFHLHRSGTLMELVDPRLGSEF-----NKVEAERMIKIALLCTNASPSLRPTMSEVVSML 698
            EF  E+ +IS +QH NLVK+ GC +EG + LLVYEY+ N SL   LF    S++ LNW  R  I LG A GLA+LH  S  +I+HRDIK +NVLLD  LNPKI+DFGLA+    +KTH+ST +AGT+GYMAPEY + G LT KADVYSFGV+ LEI  G    ++VP++       W  +L+    L+E +DP L  EF     ++ EA +++++ LLCT ASPSLRP+M EV+ ML
Sbjct:  355 EFFNEVNLISGIQHKNLVKLLGCSIEGPESLLVYEYVPNKSLDQFLFDESQSKV-LNWSQRLNIILGTAEGLAYLHGGSPVRIIHRDIKTSNVLLDDQLNPKIADFGLARCFGLDKTHLSTGIAGTLGYMAPEYVVRGQLTEKADVYSFGVLVLEIACGTRINAFVPETGHLLQRVW--NLYTLNRLVEALDPCLKDEFLQVQGSEAEACKVLRVGLLCTQASPSLRPSMEEVIRML 588          
BLAST of FC929266 vs. ExPASy Swiss-Prot
Match: CRK35_ARATH (Putative cysteine-rich receptor-like protein kinase 35 OS=Arabidopsis thaliana GN=CRK35 PE=3 SV=2)

HSP 1 Score: 218.009 bits (554), Expect = 4.732e-56
Identity = 116/249 (46.59%), Postives = 168/249 (67.47%), Query Frame = 3
Query:    3 EFLYEIAMISCLQHPNLVKIHGCCVEGDQLLLVYEYMENNSLAHALFGGENSQLKLNWPVRQKICLGIARGLAFLHEESRFKIVHRDIKATNVLLDRDLNPKISDFGLAKLDEEEKTHIST-RVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVSGKNNMS-YVPDSNCTCPLDWAFHLHRSGTLMELVDPRLGSEFNKVEAERMIKIALLCTNASPSLRPTMSEVVSMLEGSSNIPDVIPEAGG 743
            EF  E  ++S LQH NLV++ G C+EG++ +LVYE++ N SL + LF     Q +L+W  R  I  GIARG+ +LH++SR  I+HRD+KA+N+LLD D+NPKI+DFG+A++   +++  +T R+AGT GYM+PEYA+ G+ + K+DVYSFGV+ LEI+SGK N S Y  D + +  +  A+ L R+G+ +ELVDP +G  +   EA R I IALLC    P+ RP +  ++ ML  S+    V P A G
Sbjct:  385 EFKNEAVLVSKLQHKNLVRLLGFCLEGEEKILVYEFVPNKSLDYFLFDPAK-QGELDWTRRYNIIGGIARGILYLHQDSRLTIIHRDLKASNILLDADMNPKIADFGMARIFGVDQSQANTRRIAGTFGYMSPEYAMRGHFSMKSDVYSFGVLVLEIISGKKNSSFYNIDDSGSNLVTHAWRLWRNGSPLELVDPTIGESYQSSEATRCIHIALLCVQEDPADRPLLPAIIMMLTSSTTTLHV-PRAPG 631          
The following BLAST results are available for this feature:
BLAST of FC929266 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
Y5344_ARATH3.352e-9468.44Probable LRR receptor-like serine/threonine-protei... [more]
Y5343_ARATH2.173e-9368.08Probable LRR receptor-like serine/threonine-protei... [more]
Y1765_ARATH1.408e-9263.98Probable LRR receptor-like serine/threonine-protei... [more]
RKF1_ARATH4.531e-9163.71Probable LRR receptor-like serine/threonine-protei... [more]
Y1534_ARATH1.318e-9068.07Probable LRR receptor-like serine/threonine-protei... [more]
Y5614_ARATH4.552e-7557.48Probable LRR receptor-like serine/threonine-protei... [more]
Y1561_ARATH2.761e-7256.30Probable LRR receptor-like serine/threonine-protei... [more]
CRK3_ARATH3.060e-6351.90Cysteine-rich receptor-like protein kinase 3 OS=Ar... [more]
CRK42_ARATH1.330e-5851.48Cysteine-rich receptor-like protein kinase 42 OS=A... [more]
CRK35_ARATH4.732e-5646.59Putative cysteine-rich receptor-like protein kinas... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH2AF05RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH2AF05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929266 ID=FC929266|Name=FC929266|organism=Citrus clementina|type=EST|length=793bp
GTGAATTCTTATATGAGATAGCCATGATTTCGTGTTTGCAACACCCAAAT
CTTGTTAAAATTCATGGCTGTTGTGTTGAAGGGGATCAACTCTTGCTAGT
ATATGAATACATGGAAAACAACAGCCTTGCCCATGCTTTATTCGGTGGCG
AAAACAGTCAACTGAAATTGAACTGGCCAGTGAGGCAGAAGATCTGCCTT
GGGATAGCCAGAGGTTTAGCTTTTCTACATGAAGAATCCAGATTCAAAAT
AGTTCATAGAGACATCAAAGCTACGAATGTTCTGCTAGATAGAGATTTAA
ACCCCAAAATATCTGACTTTGGACTGGCTAAGCTTGATGAGGAGGAAAAA
ACTCACATCAGTACTCGAGTTGCTGGAACAATAGGATATATGGCACCAGA
GTACGCTCTATGGGGTTACTTGACCTACAAAGCAGATGTTTACAGTTTCG
GAGTTGTGGCTTTGGAAATCGTCAGTGGGAAGAATAATATGAGTTATGTG
CCAGACAGTAATTGCACCTGTCCTCTTGACTGGGCCTTCCATTTACACCG
AAGTGGTACGTTAATGGAGTTAGTGGATCCAAGGCTCGGATCAGAATTCA
ACAAGGTTGAAGCAGAGAGAATGATTAAAATAGCACTCTTATGCACCAAT
GCGTCACCTTCACTAAGGCCAACCATGTCTGAAGTGGTAAGCATGCTGGA
AGGATCTTCTAACATTCCGGATGTAATCCCTGAAGCCGGTGGTTTGAGTG
AAGACTTGAGGTTTAAAACTCTAAGAGAACATCCAAGAGAAAT
back to top