FC929268

Overview
NameFC929268
Unique NameFC929268
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length805
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15026 contig Ccv1_Contig15026:1..805. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929268 vs. ExPASy Swiss-Prot
Match: ACA8_ARATH (Calcium-transporting ATPase 8, plasma membrane-type OS=Arabidopsis thaliana GN=ACA8 PE=1 SV=1)

HSP 1 Score: 293.123 bits (749), Expect = 1.197e-78
Identity = 150/174 (86.21%), Postives = 159/174 (91.38%), Query Frame = 2
Query:  233 QADIGLAMGIQGTEVAKESSDIIILDDNFASVVKVVRWGRSVYANIQKFIQFQLTVNVAALVINFVAAVSSGDVPLNAVQLLWVNLIMDTLGALALATEPPTDHLMQRSPVGRREPLITNIMWRNLLIQASYQVSVLLVLNFQGKRILNLESDSXAHSNKVKNTLIFNSFVLCQ 754
            +ADIGLAMGI GTEVAKESSDIIILDDNFASVVKVVRWGRSVYANIQKFIQFQLTVNVAALVIN VAA+SSGDVPL AVQLLWVNLIMDTLGALALATEPPTDHLM R PVGR+EPLITNIMWRNLLIQA YQVSVLL LNF+G  IL LE +   H+ +VKNT+IFN+FVLCQ
Sbjct:  795 EADIGLAMGIAGTEVAKESSDIIILDDNFASVVKVVRWGRSVYANIQKFIQFQLTVNVAALVINVVAAISSGDVPLTAVQLLWVNLIMDTLGALALATEPPTDHLMGRPPVGRKEPLITNIMWRNLLIQAIYQVSVLLTLNFRGISILGLEHEVHEHATRVKNTIIFNAFVLCQ 968          
BLAST of FC929268 vs. ExPASy Swiss-Prot
Match: ACA9_ARATH (Calcium-transporting ATPase 9, plasma membrane-type OS=Arabidopsis thaliana GN=ACA9 PE=2 SV=2)

HSP 1 Score: 292.352 bits (747), Expect = 2.041e-78
Identity = 146/175 (83.43%), Postives = 162/175 (92.57%), Query Frame = 2
Query:  233 QADIGLAMGIQGTEVAKESSDIIILDDNFASVVKVVRWGRSVYANIQKFIQFQLTVNVAALVINFVAAVSSGDVPLNAVQLLWVNLIMDTLGALALATEPPTDHLMQRSPVGRREPLITNIMWRNLLIQASYQVSVLLVLNFQGKRILNLESDSXAHSNKVKNTLIFNSFVLCQV 757
            +ADIGL+MGI GTEVAKESSDIIILDDNFASVVKVVRWGRSVYANIQKFIQFQLTVNVAAL+IN VAA+SSGDVPL AVQLLWVNLIMDTLGALALATEPPTDHLM R+PVGRREPLITNIMWRNLL+Q+ YQV+VLLVLNF G  IL L  ++ AH+ +VKNT+IFN+FV+CQ+
Sbjct:  812 EADIGLSMGISGTEVAKESSDIIILDDNFASVVKVVRWGRSVYANIQKFIQFQLTVNVAALIINVVAAMSSGDVPLKAVQLLWVNLIMDTLGALALATEPPTDHLMHRTPVGRREPLITNIMWRNLLVQSFYQVAVLLVLNFAGLSILGLNHENHAHAVEVKNTMIFNAFVMCQI 986          
BLAST of FC929268 vs. ExPASy Swiss-Prot
Match: ACA10_ARATH (Calcium-transporting ATPase 10, plasma membrane-type OS=Arabidopsis thaliana GN=ACA10 PE=1 SV=2)

HSP 1 Score: 284.648 bits (727), Expect = 4.256e-76
Identity = 146/175 (83.43%), Postives = 160/175 (91.43%), Query Frame = 2
Query:  233 QADIGLAMGIQGTEVAKESSDIIILDDNFASVVKVVRWGRSVYANIQKFIQFQLTVNVAALVINFVAAVSSGDVPLNAVQLLWVNLIMDTLGALALATEPPTDHLMQRSPVGRREPLITNIMWRNLLIQASYQVSVLLVLNFQGKRILNLESDSXAHSNKVKNTLIFNSFVLCQV 757
            +ADIGLAMGIQGTEVAKE SDIIILDDNF SVVKVVRWGRSVYANIQKFIQFQLTVNVAALVIN VAA+S+G+VPL AVQLLWVNLIMDTLGALALATEPPTDHLM R+PVGRREPLITNIMWRNL IQA YQV+VLL+LNF+G  IL+L+S   A   +VKNT+IFN+FV+CQV
Sbjct:  799 EADIGLAMGIQGTEVAKEKSDIIILDDNFESVVKVVRWGRSVYANIQKFIQFQLTVNVAALVINVVAAISAGEVPLTAVQLLWVNLIMDTLGALALATEPPTDHLMDRAPVGRREPLITNIMWRNLFIQAMYQVTVLLILNFRGISILHLKSKPNA--ERVKNTVIFNAFVICQV 971          
BLAST of FC929268 vs. ExPASy Swiss-Prot
Match: ACA13_ARATH (Putative calcium-transporting ATPase 13, plasma membrane-type OS=Arabidopsis thaliana GN=ACA13 PE=2 SV=1)

HSP 1 Score: 263.848 bits (673), Expect = 7.774e-70
Identity = 136/175 (77.71%), Postives = 152/175 (86.86%), Query Frame = 2
Query:  233 QADIGLAMGIQGTEVAKESSDIIILDDNFASVVKVVRWGRSVYANIQKFIQFQLTVNVAALVINFVAAVSSGDVPLNAVQLLWVNLIMDTLGALALATEPPTDHLMQRSPVGRREPLITNIMWRNLLIQASYQVSVLLVLNFQGKRILNLESDSXAHSNKVKNTLIFNSFVLCQV 757
            +ADIGL+MGIQGTEVAKESSDI+ILDDNFASV  V++WGR VY NIQKFIQFQLTVNVAALVINFVAAVS+GDVPL AVQLLWVNLIMDTLGALALATE PT+ LM++ P+GR  PLITNIMWRNLL QA YQ+SVLLVL F+G+ I N+       + KVKNTLIFN+FVLCQV
Sbjct:  757 EADIGLSMGIQGTEVAKESSDIVILDDNFASVATVLKWGRCVYNNIQKFIQFQLTVNVAALVINFVAAVSAGDVPLTAVQLLWVNLIMDTLGALALATEKPTNDLMKKKPIGRVAPLITNIMWRNLLAQAFYQISVLLVLQFRGRSIFNV-------TEKVKNTLIFNTFVLCQV 924          
BLAST of FC929268 vs. ExPASy Swiss-Prot
Match: ACA12_ARATH (Putative calcium-transporting ATPase 12, plasma membrane-type OS=Arabidopsis thaliana GN=ACA12 PE=2 SV=1)

HSP 1 Score: 253.832 bits (647), Expect = 8.045e-67
Identity = 127/175 (72.57%), Postives = 151/175 (86.29%), Query Frame = 2
Query:  233 QADIGLAMGIQGTEVAKESSDIIILDDNFASVVKVVRWGRSVYANIQKFIQFQLTVNVAALVINFVAAVSSGDVPLNAVQLLWVNLIMDTLGALALATEPPTDHLMQRSPVGRREPLITNIMWRNLLIQASYQVSVLLVLNFQGKRILNLESDSXAHSNKVKNTLIFNSFVLCQV 757
            +ADIGL+MGIQGTEVAKESSDI+ILDDNFASV  V++WGR VY NIQKFIQFQLTVNVAALVINF+AA+S+G+VPL AVQLLWVNLIMDTLGALALATE PT+ L++R PVGR E LITN+MWRNLL+Q+ YQ++VLL+L F+G  I ++  +       VK+TLIFN+FVLCQV
Sbjct:  761 EADIGLSMGIQGTEVAKESSDIVILDDNFASVATVLKWGRCVYNNIQKFIQFQLTVNVAALVINFIAAISAGEVPLTAVQLLWVNLIMDTLGALALATERPTNELLKRKPVGRTEALITNVMWRNLLVQSLYQIAVLLILQFKGMSIFSVRKE-------VKDTLIFNTFVLCQV 928          
BLAST of FC929268 vs. ExPASy Swiss-Prot
Match: ACA11_ARATH (Putative calcium-transporting ATPase 11, plasma membrane-type OS=Arabidopsis thaliana GN=ACA11 PE=2 SV=1)

HSP 1 Score: 233.802 bits (595), Expect = 8.615e-61
Identity = 116/175 (66.29%), Postives = 140/175 (80.00%), Query Frame = 2
Query:  233 QADIGLAMGIQGTEVAKESSDIIILDDNFASVVKVVRWGRSVYANIQKFIQFQLTVNVAALVINFVAAVSSGDVPLNAVQLLWVNLIMDTLGALALATEPPTDHLMQRSPVGRREPLITNIMWRNLLIQASYQVSVLLVLNFQGKRILNLESDSXAHSNKVKNTLIFNSFVLCQV 757
            +ADIGLAMGI GTEVAKE++D+II+DDNFA++V V +WGR+VY NIQKF+QFQLTVNV AL+INFV+A  +G  PL AVQLLWVN+IMDTLGALALATEPP + LM+R P+GR    IT  MWRN++ Q+ YQ+ VL +LNF GK+ILNL       S  V NT+IFNSFV CQV
Sbjct:  756 EADIGLAMGIAGTEVAKENADVIIMDDNFATIVNVAKWGRAVYINIQKFVQFQLTVNVVALIINFVSACITGSAPLTAVQLLWVNMIMDTLGALALATEPPNEGLMKRQPIGRTASFITRAMWRNIIGQSIYQLIVLGILNFAGKQILNLNGPD---STIVLNTIIFNSFVFCQV 927          
BLAST of FC929268 vs. ExPASy Swiss-Prot
Match: ACA2_ORYSJ (Calcium-transporting ATPase 2, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os03g0616400 PE=2 SV=1)

HSP 1 Score: 233.032 bits (593), Expect = 1.470e-60
Identity = 112/175 (64.00%), Postives = 143/175 (81.71%), Query Frame = 2
Query:  233 QADIGLAMGIQGTEVAKESSDIIILDDNFASVVKVVRWGRSVYANIQKFIQFQLTVNVAALVINFVAAVSSGDVPLNAVQLLWVNLIMDTLGALALATEPPTDHLMQRSPVGRREPLITNIMWRNLLIQASYQVSVLLVLNFQGKRILNLESDSXAHSNKVKNTLIFNSFVLCQV 757
            +ADIGLAMGI GTEVAKES+D++ILDDNF+++V V +WGRSVY NIQKF+QFQLTVNV AL++NF +A  +GD PL AVQLLWVN+IMDTLGALALATEPP ++LM+++PVGR+   ITN+MWRN++ Q+ YQ +V+  L  QGK +  LE     H++ V NT+IFN+FV CQV
Sbjct:  772 EADIGLAMGIAGTEVAKESADVVILDDNFSTIVTVAKWGRSVYVNIQKFVQFQLTVNVVALLVNFTSACFTGDAPLTAVQLLWVNMIMDTLGALALATEPPNNNLMKKAPVGRKGKFITNVMWRNIVGQSLYQFAVMWYLQTQGKHLFGLEG---YHADIVLNTIIFNTFVFCQV 943          
BLAST of FC929268 vs. ExPASy Swiss-Prot
Match: ACA5_ORYSJ (Probable calcium-transporting ATPase 5, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os11g0140400 PE=3 SV=1)

HSP 1 Score: 229.95 bits (585), Expect = 1.244e-59
Identity = 113/175 (64.57%), Postives = 139/175 (79.43%), Query Frame = 2
Query:  233 QADIGLAMGIQGTEVAKESSDIIILDDNFASVVKVVRWGRSVYANIQKFIQFQLTVNVAALVINFVAAVSSGDVPLNAVQLLWVNLIMDTLGALALATEPPTDHLMQRSPVGRREPLITNIMWRNLLIQASYQVSVLLVLNFQGKRILNLESDSXAHSNKVKNTLIFNSFVLCQV 757
            +ADIGLAMGI GTEVAKES+D+I+LDDNF +++ V RWGR+VY NIQKF+QFQLTVN+ ALVINFV+A  +G  PL AVQLLWVN+IMDTLGALALATEPP D +M+R PV + E  IT +MWRN++ Q+ YQ+ VL  L F G+ +LN++    A S  + NTLIFNSFV CQV
Sbjct:  746 EADIGLAMGIAGTEVAKESADVIVLDDNFTTIINVARWGRAVYINIQKFVQFQLTVNIVALVINFVSACITGSAPLTAVQLLWVNMIMDTLGALALATEPPNDEMMKRPPVRKGESFITKVMWRNIMGQSLYQLFVLGALMFGGESLLNIKG---ADSKSIINTLIFNSFVFCQV 917          
BLAST of FC929268 vs. ExPASy Swiss-Prot
Match: ACA4_ORYSJ (Probable calcium-transporting ATPase 4, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os12g0136900 PE=3 SV=1)

HSP 1 Score: 229.95 bits (585), Expect = 1.244e-59
Identity = 114/175 (65.14%), Postives = 138/175 (78.86%), Query Frame = 2
Query:  233 QADIGLAMGIQGTEVAKESSDIIILDDNFASVVKVVRWGRSVYANIQKFIQFQLTVNVAALVINFVAAVSSGDVPLNAVQLLWVNLIMDTLGALALATEPPTDHLMQRSPVGRREPLITNIMWRNLLIQASYQVSVLLVLNFQGKRILNLESDSXAHSNKVKNTLIFNSFVLCQV 757
            +ADIGLAMGI GTEVAKES+D+I+LDDNF +++ V RWGR+VY NIQKF+QFQLTVN+ ALVINFV+A   G  PL AVQLLWVN+IMDTLGALALATEPP D +M+R PV + E  IT  MWRN++ Q+ YQ+ VL  L F G+R+LN++    A S  + NTLIFNSFV CQV
Sbjct:  768 EADIGLAMGIAGTEVAKESADVIVLDDNFTTIINVARWGRAVYINIQKFVQFQLTVNIVALVINFVSACIIGSAPLTAVQLLWVNMIMDTLGALALATEPPNDEMMKRPPVRKGESFITKFMWRNIMGQSLYQLFVLGALMFGGERLLNIKG---ADSKSIINTLIFNSFVFCQV 939          
BLAST of FC929268 vs. ExPASy Swiss-Prot
Match: ACA2_ARATH (Calcium-transporting ATPase 2, plasma membrane-type OS=Arabidopsis thaliana GN=ACA2 PE=1 SV=1)

HSP 1 Score: 228.409 bits (581), Expect = 3.620e-59
Identity = 116/175 (66.29%), Postives = 136/175 (77.71%), Query Frame = 2
Query:  233 QADIGLAMGIQGTEVAKESSDIIILDDNFASVVKVVRWGRSVYANIQKFIQFQLTVNVAALVINFVAAVSSGDVPLNAVQLLWVNLIMDTLGALALATEPPTDHLMQRSPVGRREPLITNIMWRNLLIQASYQVSVLLVLNFQGKRILNLESDSXAHSNKVKNTLIFNSFVLCQV 757
            +ADIGLAMGI GTEVAKES+D+IILDDNF+++V V +WGRSVY NIQKF+QFQLTVNV ALV+NF +A  +G  PL AVQLLWVN+IMDTLGALALATEPP D LM+R PVGRR   ITN MWRN+L QA YQ  V+ +L  +GK +  L+      S  + NTLIFN FV CQV
Sbjct:  765 EADIGLAMGIAGTEVAKESADVIILDDNFSTIVTVAKWGRSVYINIQKFVQFQLTVNVVALVVNFSSACLTGSAPLTAVQLLWVNMIMDTLGALALATEPPNDELMKRLPVGRRGNFITNAMWRNILGQAVYQFIVIWILQAKGKAMFGLDGPD---STLMLNTLIFNCFVFCQV 936          
The following BLAST results are available for this feature:
BLAST of FC929268 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 132
Match NameE-valueIdentityDescription
ACA8_ARATH1.197e-7886.21Calcium-transporting ATPase 8, plasma membrane-typ... [more]
ACA9_ARATH2.041e-7883.43Calcium-transporting ATPase 9, plasma membrane-typ... [more]
ACA10_ARATH4.256e-7683.43Calcium-transporting ATPase 10, plasma membrane-ty... [more]
ACA13_ARATH7.774e-7077.71Putative calcium-transporting ATPase 13, plasma me... [more]
ACA12_ARATH8.045e-6772.57Putative calcium-transporting ATPase 12, plasma me... [more]
ACA11_ARATH8.615e-6166.29Putative calcium-transporting ATPase 11, plasma me... [more]
ACA2_ORYSJ1.470e-6064.00Calcium-transporting ATPase 2, plasma membrane-typ... [more]
ACA5_ORYSJ1.244e-5964.57Probable calcium-transporting ATPase 5, plasma mem... [more]
ACA4_ORYSJ1.244e-5965.14Probable calcium-transporting ATPase 4, plasma mem... [more]
ACA2_ARATH3.620e-5966.29Calcium-transporting ATPase 2, plasma membrane-typ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH2AF07RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH2AF07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929268 ID=FC929268|Name=FC929268|organism=Citrus clementina|type=EST|length=805bp
GATGGCACTAATGATGCTCCTGCCCTACATGAGGTGAAATGGATGTGATT
CTACTTTGATATTTTATATTCTTACGTGAGAGTGTATTTAAAATTTCTGT
TTCATCGTCAATGTTTTTAAATCATCTGGACTACTAGAACAGTTTCGTAT
TGGAGTTAAACGAGTCAGGGTGGCCTGGCAACATGCACTAAATATGATAT
TATAGCTAACGGAATTAAGTCATTTTGAAGTTCAGGCAGACATTGGTCTG
GCAATGGGTATTCAAGGAACCGAGGTTGCTAAAGAGAGCTCAGATATTAT
TATCTTGGACGACAATTTTGCTTCAGTTGTGAAGGTTGTCAGATGGGGTC
GTTCTGTATATGCAAATATCCAGAAATTCATCCAGTTTCAGCTTACTGTC
AATGTCGCAGCTCTCGTCATTAATTTTGTGGCTGCTGTTTCCTCTGGTGA
TGTTCCCCTCAATGCAGTGCAGCTTCTCTGGGTTAACCTCATCATGGATA
CCCTGGGAGCCTTAGCCTTGGCTACTGAACCACCAACTGATCACCTGATG
CAGAGGTCCCCAGTTGGTCGAAGAGAACCTCTTATAACTAATATAATGTG
GAGGAATCTCTTAATACAGGCTTCCTACCAAGTAAGTGTCCTGCTTGTCC
TGAATTTTCAAGGGAAGAGGATTCTGAACCTGGAGAGTGATTCCNATGCC
CATTCCAACAAAGTAAAAAATACTCTGATATTCAATTCTTTTGTCCTTTG
CCAGGTTAGTAAATTATCAGGGAATACAATAATTTGTTAAGTTGAGCTTC
TGTTT
back to top