FC929356

Overview
NameFC929356
Unique NameFC929356
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length542
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15015 contig Ccv1_Contig15015:1..542. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929356 vs. ExPASy Swiss-Prot
Match: SCP52_ARATH (Putative serine carboxypeptidase-like 52 OS=Arabidopsis thaliana GN=SCPL52 PE=5 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 1.766e-24
Identity = 52/115 (45.22%), Postives = 74/115 (64.35%), Query Frame = 1
Query:   22 DKSLSYTTNVLSSVDYHRNFIKKGYQVLIYSGDVDMGTSYVGTETWIKSLNLTIDSGWQPWLVDGQVAGFWMRYAEKNLYRLTFATVKGAGHTAPEYKPKECLEMINRWFAMYPL 366
            + ++ Y  +++SS+ YH N    GY+ LIYSGD DM   ++ TE WI+SLN  I   W+PW+++ Q+AG+ M YA K    +T+AT+K +GHTA EYKP E   M  RW +  PL
Sbjct:   75 NSNIHYDDDIISSIPYHMNNSINGYRSLIYSGDHDMEVPFLATEAWIRSLNYPIIDDWRPWIINNQIAGYTMTYANK----MTYATIKASGHTA-EYKPAESFIMFQRWISGQPL 184          
BLAST of FC929356 vs. ExPASy Swiss-Prot
Match: SCP13_ARATH (Serine carboxypeptidase-like 13 OS=Arabidopsis thaliana GN=SCPL13 PE=2 SV=2)

HSP 1 Score: 112.079 bits (279), Expect = 1.766e-24
Identity = 53/114 (46.49%), Postives = 75/114 (65.79%), Query Frame = 1
Query:   25 KSLSYTTNVLSSVDYHRNFIKKGYQVLIYSGDVDMGTSYVGTETWIKSLNLTIDSGWQPWLVDGQVAGFWMRYAEKNLYRLTFATVKGAGHTAPEYKPKECLEMINRWFAMYPL 366
            K++SY  ++ SSV YH      GY+ LIY+GD DM   ++ T+ WI+SLN +I   W+PW+++ Q+AG+   Y+ K    +TFAT+KG+GHTA EYKPKE   M  RW +  PL
Sbjct:  322 KNISYNYDIKSSVAYHMKNSIDGYRSLIYNGDHDMMVPFLATQAWIRSLNYSITDDWKPWMINDQIAGYTRSYSNK----MTFATIKGSGHTA-EYKPKETSIMFKRWISAQPL 430          
BLAST of FC929356 vs. ExPASy Swiss-Prot
Match: SCP6_ARATH (Serine carboxypeptidase-like 6 OS=Arabidopsis thaliana GN=SCPL6 PE=2 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 2.307e-24
Identity = 56/109 (51.38%), Postives = 69/109 (63.30%), Query Frame = 1
Query:   22 DKSLSYTTNVLSSVDYHRNFIKKGYQVLIYSGDVDMGTSYVGTETWIKSLNLTIDSGWQPWLVDGQVAGFWMRYAEKNLYRLTFATVKGAGHTAPEYKPKECLEMINRW 348
            D S  YT +++SSV YH N    GY+ LI+SGD D     +GT+ WIKSLN  I   W+PW+++ QVAG+   YA K    +TFATVKG GHTA EYKP E   M  RW
Sbjct:  332 DWSKPYTKDIISSVPYHMNNSINGYRSLIFSGDHDFEVPLIGTQVWIKSLNYAIVDKWRPWMINNQVAGYTRTYANK----MTFATVKGGGHTA-EYKPDETFIMFQRW 435          
BLAST of FC929356 vs. ExPASy Swiss-Prot
Match: SCP17_ARATH (Serine carboxypeptidase-like 17 OS=Arabidopsis thaliana GN=SCPL17 PE=2 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 3.013e-24
Identity = 54/112 (48.21%), Postives = 74/112 (66.07%), Query Frame = 1
Query:   31 LSYTTNVLSSVDYHRNFIKKGYQVLIYSGDVDMGTSYVGTETWIKSLNLTIDSGWQPWLVDGQVAGFWMRYAEKNLYRLTFATVKGAGHTAPEYKPKECLEMINRWFAMYPL 366
            ++Y  ++ SSV YH+    +GY+ L++SGD DM   ++GT+ WI+SLN +I   W+PW+V  QVAG+   YA K    +TFATVKG GHT+ EYKP E   MI RW +  PL
Sbjct:  331 IAYNKDIRSSVPYHKYISIEGYRSLVFSGDHDMLVPFLGTQAWIRSLNYSIVDDWRPWMVQNQVAGYTRTYANK----MTFATVKGGGHTS-EYKPVETYIMIKRWLSGQPL 437          
BLAST of FC929356 vs. ExPASy Swiss-Prot
Match: CBP1_ORYSJ (Serine carboxypeptidase 1 OS=Oryza sativa subsp. japonica GN=CBP1 PE=2 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 6.712e-24
Identity = 53/111 (47.75%), Postives = 68/111 (61.26%), Query Frame = 1
Query:   43 TNVL-------SSVDYHRNFIKKGYQVLIYSGDVDMGTSYVGTETWIKSLNLTIDSGWQPWLVDGQVAGFWMRYAEKNLYRLTFATVKGAGHTAPEYKPKECLEMINRWFA 354
            TNVL       S + YH+N   +GY+  IYSGD DM   Y GTE W +SL   +   W+PW ++GQV+G+   Y     + LTFAT+KGAGHT PEYKP+E L   +RW A
Sbjct:  400 TNVLDFIHDAGSMISYHKNLTGQGYRAFIYSGDHDMCVPYTGTEAWTRSLGYGVIDSWRPWHLNGQVSGYTQGYE----HGLTFATIKGAGHTVPEYKPQESLAFYSRWLA 506          
BLAST of FC929356 vs. ExPASy Swiss-Prot
Match: SCP18_ARATH (Serine carboxypeptidase-like 18 OS=Arabidopsis thaliana GN=SCPL18 PE=2 SV=2)

HSP 1 Score: 109.768 bits (273), Expect = 8.766e-24
Identity = 57/113 (50.44%), Postives = 70/113 (61.95%), Query Frame = 1
Query:   31 LSYTTNVLSSVDYHRN-FIKKGYQVLIYSGDVDMGTSYVGTETWIKSLNLTIDSGWQPWLVDGQVAGFWMRYAEKNLYRLTFATVKGAGHTAPEYKPKECLEMINRWFAMYPL 366
            L Y  ++ SSV YHRN  I   Y+ L+YS D DM   Y+GTE WIKSLN +I   W+PW V+ QV G+   YA      +TFAT+KG GHTA EYKP+E   M  RW +  PL
Sbjct:  357 LPYEKDIKSSVPYHRNNSIIGDYRSLVYSSDHDMMVPYIGTEAWIKSLNYSITDDWRPWFVNNQVIGYTRTYAN----NMTFATIKGGGHTA-EYKPEESFMMFQRWISGRPL 464          
BLAST of FC929356 vs. ExPASy Swiss-Prot
Match: SCP7_ARATH (Serine carboxypeptidase-like 7 OS=Arabidopsis thaliana GN=SCPL7 PE=2 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 1.145e-23
Identity = 52/112 (46.43%), Postives = 70/112 (62.50%), Query Frame = 1
Query:   31 LSYTTNVLSSVDYHRNFIKKGYQVLIYSGDVDMGTSYVGTETWIKSLNLTIDSGWQPWLVDGQVAGFWMRYAEKNLYRLTFATVKGAGHTAPEYKPKECLEMINRWFAMYPL 366
            + Y  ++ SSV YH N    GY  LI+SGD DM   Y+GT+ WI+SLN ++   W+PW++  Q+AG+   YA K    + FAT+KG GHT PEYKP+E   M  RW +  PL
Sbjct:  331 IPYNHDIKSSVPYHMNNSIDGYASLIFSGDHDMEVPYLGTQAWIRSLNYSLIDDWRPWMIGDQIAGYTRTYANK----MAFATIKGGGHT-PEYKPEESYIMFQRWISGQPL 437          
BLAST of FC929356 vs. ExPASy Swiss-Prot
Match: SCP1_ARATH (Serine carboxypeptidase-like 1 OS=Arabidopsis thaliana GN=SCPL1 PE=2 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 2.550e-23
Identity = 54/113 (47.79%), Postives = 70/113 (61.95%), Query Frame = 1
Query:   28 SLSYTTNVLSSVDYHRNFIKKGYQVLIYSGDVDMGTSYVGTETWIKSLNLTIDSGWQPWLVDGQVAGFWMRYAEKNLYRLTFATVKGAGHTAPEYKPKECLEMINRWFAMYPL 366
            S+ Y  ++ SS+ YH N    GY+ LIYSGD D    Y+GT+ WI+SLN +I   W+PW+V  Q+AG+   YA K    +TFAT+KG GHTA E KP+E   M  RW    PL
Sbjct:  334 SIPYNNDIKSSMPYHVNNSISGYRSLIYSGDHDFEVPYLGTQAWIRSLNYSIIDDWRPWMVKNQIAGYTRTYANK----MTFATIKGGGHTA-ESKPEEASIMFQRWINGQPL 441          
BLAST of FC929356 vs. ExPASy Swiss-Prot
Match: SCP2_ARATH (Serine carboxypeptidase-like 2 OS=Arabidopsis thaliana GN=SCPL2 PE=2 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 3.331e-23
Identity = 51/114 (44.74%), Postives = 72/114 (63.16%), Query Frame = 1
Query:   25 KSLSYTTNVLSSVDYHRNFIKKGYQVLIYSGDVDMGTSYVGTETWIKSLNLTIDSGWQPWLVDGQVAGFWMRYAEKNLYRLTFATVKGAGHTAPEYKPKECLEMINRWFAMYPL 366
            +++ Y  ++ SS+ YH N    GY+ LIYSGD D+   Y+GT+ WI+SLN +I   W+PW++  Q+AG+   YA K    +TFAT+KG GHT  E+KP+E   M  RW    PL
Sbjct:  333 RTIPYDNDIKSSMPYHVNNSISGYRSLIYSGDHDLEVPYLGTQAWIRSLNYSIIDDWRPWMIKNQIAGYTRTYANK----MTFATIKGGGHTI-EFKPEEASIMFQRWINGQPL 441          
BLAST of FC929356 vs. ExPASy Swiss-Prot
Match: SCP21_ARATH (Serine carboxypeptidase-like 21 OS=Arabidopsis thaliana GN=SCPL21 PE=2 SV=2)

HSP 1 Score: 107.842 bits (268), Expect = 3.331e-23
Identity = 49/109 (44.95%), Postives = 68/109 (62.39%), Query Frame = 1
Query:   28 SLSYTTNVLSSVDYHRNFIKKGYQVLIYSGDVDMGTSYVGTETWIKSLNLTIDSGWQPWLVDGQVAGFWMRYAEKNLYRLTFATVKGAGHTAPEYKPKECLEMINRWFA 354
            +L Y  +  S ++YHRN    G++ LI+SGD DM   Y G+E W K++   +   W+PW+ + QVAGF   YA      LTF T+KGAGHT PEYKP+E L+  +R+ A
Sbjct:  386 NLEYRHDTGSMIEYHRNLTLSGFRALIFSGDHDMCVPYTGSEAWTKAMGYKVVDEWRPWMSNNQVAGFTQGYAN----NLTFLTIKGAGHTVPEYKPRESLDFYSRFLA 490          
The following BLAST results are available for this feature:
BLAST of FC929356 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 34
Match NameE-valueIdentityDescription
SCP52_ARATH1.766e-2445.22Putative serine carboxypeptidase-like 52 OS=Arabid... [more]
SCP13_ARATH1.766e-2446.49Serine carboxypeptidase-like 13 OS=Arabidopsis tha... [more]
SCP6_ARATH2.307e-2451.38Serine carboxypeptidase-like 6 OS=Arabidopsis thal... [more]
SCP17_ARATH3.013e-2448.21Serine carboxypeptidase-like 17 OS=Arabidopsis tha... [more]
CBP1_ORYSJ6.712e-2447.75Serine carboxypeptidase 1 OS=Oryza sativa subsp. j... [more]
SCP18_ARATH8.766e-2450.44Serine carboxypeptidase-like 18 OS=Arabidopsis tha... [more]
SCP7_ARATH1.145e-2346.43Serine carboxypeptidase-like 7 OS=Arabidopsis thal... [more]
SCP1_ARATH2.550e-2347.79Serine carboxypeptidase-like 1 OS=Arabidopsis thal... [more]
SCP2_ARATH3.331e-2344.74Serine carboxypeptidase-like 2 OS=Arabidopsis thal... [more]
SCP21_ARATH3.331e-2344.95Serine carboxypeptidase-like 21 OS=Arabidopsis tha... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH2BB03RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH2BB03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929356 ID=FC929356|Name=FC929356|organism=Citrus clementina|type=EST|length=542bp
CTCGTGCCGAATCGGCACGAGGATAAAAGTTTATCTTACACAACAAATGT
CCTGAGTAGTGTTGATTATCATCGCAACTTCATCAAGAAGGGCTACCAAG
TTTTGATTTACAGTGGCGATGTGGACATGGGAACTTCATATGTAGGCACA
GAAACATGGATTAAGTCATTAAATTTGACGATTGATAGTGGCTGGCAGCC
GTGGCTTGTGGACGGCCAAGTTGCAGGATTTTGGATGCGGTATGCTGAAA
AGAACCTTTACCGTTTGACATTTGCCACAGTAAAGGGAGCAGGTCATACG
GCTCCAGAGTACAAGCCTAAGGAATGCCTCGAAATGATTAACAGGTGGTT
TGCCATGTATCCTCTTTGAAGCCATGTTCAGTACTTTGAGAATGGAAATG
TATTGGATTATGTTGTATTGCATTAACATTATATTACAATAATGTTGTAC
GGTGTTTAGCGCTGCACTGTACTGTATTAATTTCATATAATATTACATTA
ATGTTATTTAAATGTATTAGTAGATAAAAAAAAAAAAAAAAA
back to top