FC929423

Overview
NameFC929423
Unique NameFC929423
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length272
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14413 contig Ccv1_Contig14413:629..900. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929423 vs. ExPASy Swiss-Prot
Match: Y1669_ARATH (Uncharacterized oxidoreductase At1g06690, chloroplastic OS=Arabidopsis thaliana GN=At1g06690 PE=1 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 1.074e-41
Identity = 81/90 (90.00%), Postives = 87/90 (96.67%), Query Frame = 3
Query:    3 LGDAVEQGLVKAVGVSNYSEKRLRNAYEKLKKRGIPLASNQVNYSLIYRKPEENGVKAACDELGITLIAYCPIAQGALTGKYTPQNPPTG 272
            LGDAVEQGLVKAVGVSNYSEKRLR+AYE+LKKRGIPLASNQVNYSLIYR PE+ GVKAACDELG+TLIAY PIAQGALTGKYTP+NPP+G
Sbjct:  193 LGDAVEQGLVKAVGVSNYSEKRLRDAYERLKKRGIPLASNQVNYSLIYRAPEQTGVKAACDELGVTLIAYSPIAQGALTGKYTPENPPSG 282          
The following BLAST results are available for this feature:
BLAST of FC929423 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
Y1669_ARATH1.074e-4190.00Uncharacterized oxidoreductase At1g06690, chloropl... [more]
back to top
Properties
Property NameValue
Genbank descriptionKN0AAH2BH11RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH2BH11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929423 ID=FC929423|Name=FC929423|organism=Citrus clementina|type=EST|length=272bp
GTCTTGGAGATGCTGTCGAGCAGGGCCTAGTGAAGGCTGTTGGTGTTTCA
AATTACAGTGAGAAACGACTTCGCAATGCTTACGAAAAGCTTAAAAAGAG
AGGAATTCCATTAGCTTCAAACCAAGTGAACTATAGCCTCATATACAGAA
AACCAGAAGAGAATGGTGTGAAGGCTGCCTGTGATGAACTTGGGATCACT
TTAATTGCATATTGTCCTATTGCTCAAGGTGCTCTCACTGGAAAGTATAC
ACCACAGAATCCACCAACTGGG
back to top