FC929468

Overview
NameFC929468
Unique NameFC929468
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length828
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14116 contig Ccv1_Contig14116:152..979. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929468 vs. ExPASy Swiss-Prot
Match: LEC2_CLALU (Agglutinin-2 OS=Cladrastis lutea PE=1 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 2.419e-13
Identity = 80/270 (29.63%), Postives = 118/270 (43.70%), Query Frame = 1
Query:   13 MIFLLLLSVFLRGASSSILSEDTPISFSFPSFAKDSCDNKTLICYG--AIESSG-ALSITPGPPPNLPIR-KVGRVLYGKPLSLQRSFID------TTITIKISRHQNYTDRAGDGMTFIFASDKNGPSAKGVGEYLGLQSSPGDKFPPL----AVELDTCLNKNLXXXXXXXXXXXXXXXESNPVNSLLDV--DLKSGRAIQVRIYYNPDFGQLSVYAAYSGETLVK--VVEKPINLSDIIPTPVYVGFTAATGDFLESHEVINWTFNS 768
            + F+ L  + L   +SS       +SF+F +F  D  D   LI  G   I S G +L +T       P+R  VGR LY  PL L  S  +      TT T  +S   + T+  GDG+ F  A  +        G  LGL S        L    AVE DT +N N                + N + S   V    ++G     +I YN D  +LSV ++Y      +   V   ++L   +P  V VGF+ +TG ++++H +++WTFNS
Sbjct:   20 LAFITLFLMLLNRVNSS-----DSLSFTFDNFRPDQRD---LILQGDAKISSGGDSLQLTKTDTSGKPVRGSVGRALYYTPLHLWDSSTNRLASFQTTFTFVLS---SPTNNPGDGIAFFIAPPETTIPPGSSGGLLGLFSPDNALNNSLNQIVAVEFDTFVNNN------WDPSHRHIGIDVNTIKSSATVRWQRENGSLATAQISYNSDTKKLSVVSSYPNTQANEDYTVSYDVDLKTELPEWVRVGFSGSTGGYVQNHNILSWTFNS 272          
BLAST of FC929468 vs. ExPASy Swiss-Prot
Match: LEC_ERYCG (Lectin OS=Erythrina crista-galli PE=1 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.734e-11
Identity = 70/241 (29.05%), Postives = 103/241 (42.74%), Query Frame = 1
Query:   85 ISFSFPSFAKDSCDNKTLICYGAIESSGALSITPGPPPNLPI-RKVGRVLYGKPLSLQRSFIDTTITIK----ISRHQNYT-DRAGDGMTFIFASDKNGPSAKGVGEYLGL--QSSPGDKFPPLAVELDTCLNKNLXXXXXXXXXXXXXXXESNPVNSLLD--VDLKSGRAIQVRIYYNPDFGQLSVYAAYSGETLVKVVEKPINLSDIIPTPVYVGFTAATG---DFLESHEVINWTFNS 768
            ISFSF  F   + DN TL     I  SG L +T      +P     GR LY KP+ +  S   T  + +     S  Q YT     DG+ F     K+ P A+G G YLG+   S   + +  LAVE DT  N                  + N + S+      L +G+   V I Y+     L V   Y     +  + + +++  ++P  V VG + ATG   D  E+H+V +W+F +
Sbjct:    4 ISFSFSEFEPGN-DNLTLQGAALITQSGVLQLTKINQNGMPAWDSTGRTLYTKPVHMWDSTTGTVASFETRFSFSIEQPYTRPLPADGLVFFMGPTKSKP-AQGYG-YLGVFNNSKQDNSYQTLAVEFDTFSNP------WDPPQVPHIGIDVNSIRSIKTQPFQLDNGQVANVVIKYDAPSKILHVVLVYPSSGAIYTIAEIVDVKQVLPDWVDVGLSGATGAQRDAAETHDVYSWSFQA 235          
BLAST of FC929468 vs. ExPASy Swiss-Prot
Match: LEC2_CYTSC (2-acetamido-2-deoxy-D-galactose-binding seed lectin 2 OS=Cytisus scoparius PE=1 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 2.264e-11
Identity = 70/245 (28.57%), Postives = 102/245 (41.63%), Query Frame = 1
Query:   85 ISFSFPSFAKDSCDNKTLICYGAIESSGALSITPGPPPNLPIRKVGRVLYGKPLSL-------QRSFIDTTITIKISRHQNYTDRAGDGMTFIFASDKNGPSAKGVGEYLGL---QSSPGDKFPPLAVELDTCLNKNLXXXXXXXXXXXXXXXESNPVNSLLDVDLKSGRAIQVRIYYNPDFGQLSVYAAY-SGETLVK---VVEKPINLSDIIPTPVYVGFTAATG---DFLESHEVINWTFNS 768
            +SFSF  F  D   N  L     I  +G L +T           +GR LY  P+ +       + SF  T  +  IS   N +  A DG+ F  A     P +   G YLGL    SS       +AVE DT  N                  +S  V+S      K+G    V I Y P    L     Y SG+T  K   ++   ++L   +P  V +GF+A TG   +++E+H++++W+F S
Sbjct:    4 LSFSFTKFKTDQ-KNLILQRDALITPTGKLQLTTVENGKPAAYSLGRALYSTPIHIWDKSTGDEASFA-TFFSFVISDAPNPSTAATDGLAFFLAPADTQPQS--AGGYLGLFEKDSSYNSSNQIVAVEFDTYYNSAWDPQTNPHIGIDVNTIKSKKVSSW---GFKNGNVATVLITYQPSSKSLVASLVYPSGQTSDKTSYIISANVDLKATVPEWVRIGFSATTGQTDNYIETHDILSWSFKS 241          
BLAST of FC929468 vs. ExPASy Swiss-Prot
Match: LECS_SOPJA (Seed lectin OS=Sophora japonica PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 3.862e-11
Identity = 68/242 (28.10%), Postives = 102/242 (42.15%), Query Frame = 1
Query:   85 ISFSFPSFAKDSCDNKTLICYG--AIESSGALSITPGPPPNLPI-RKVGRVLYGKPLSLQRSFIDTTITIKISRH----QNYTDRAGDGMTFIFASDKNGPSAKGVGEYLGLQSSPG--DKFPPLAVELDTCLNKNLXXXXXXXXXXXXXXXESNPVNSLLDVDL--KSGRAIQVRIYYNPDFGQLSVYAAYSGETLVKVVEKPINLSDIIPTPVYVGFTAATG---DFLESHEVINWTFNS 768
            +SFSFP FA +  D   L+  G   + S G L +T      +PI    GR LY  P+ +         +   S           ++ DG+ F  A   N     G G +LGL  S G    +  +AV+ DT +N                  + N +NS   V    ++G    V I Y      L+V   Y       ++   ++L  I+P  V VGFTAATG    ++E+H+V++W+F S
Sbjct:   41 LSFSFPKFASNQED---LLLQGDALVSSKGELQLTT-VENGVPIWNSTGRALYYAPVHIWDKSTGRVASFATSFSFVVKAPVASKSADGIAFFLAPPNNQIQGPG-GGHLGLFHSSGYNSSYQIIAVDFDTHINA-------WDPNTRHIGIDVNSINSTKTVTWGWQNGEVANVLISYQAATETLTVSLTYPSSQTSYILSAAVDLKSILPEWVRVGFTAATGLTTQYVETHDVLSWSFTS 270          
BLAST of FC929468 vs. ExPASy Swiss-Prot
Match: LEC_ERYCO (Lectin OS=Erythrina corallodendron PE=1 SV=3)

HSP 1 Score: 68.5514 bits (166), Expect = 5.044e-11
Identity = 77/280 (27.50%), Postives = 116/280 (41.43%), Query Frame = 1
Query:    1 AEQKMIFLLLLSVFLRGASSSILSEDTPISFSFPSFAKDSCDNKTLICYGAIESSGALSITPGPPPNLPI-RKVGRVLYGKPLSLQRSFIDTTITIK----ISRHQNYT-DRAGDGMTFIFASDKNGPSAKGVGEYLGL--QSSPGDKFPPLAVELDTCLNKNLXXXXXXXXXXXXXXXESNPVNSLLD--VDLKSGRAIQVRIYYNPDFGQLSVYAAYSGETLVKVVEKPINLSDIIPTPVYVGFTAATG---DFLESHEVINWTFNSFPVPPSLKEKN 801
            A  K+  +L LS+ L     + ++    ISFSF  F   + DN TL     I  SG L +T      +P     GR LY KP+ +      T  + +     S  Q YT     DG+ F     K+ P A+G G YLG+   S   + +  L VE DT  N                  + N + S+      L +G+   V I Y+     L     Y     +  + + +++  ++P  V VG + ATG   D  E+H+V +W+F +     SL E N
Sbjct:    2 ATYKLCSVLALSLTLFLLILNKVNSVETISFSFSEFEPGN-DNLTLQGAALITQSGVLQLTKINQNGMPAWDSTGRTLYAKPVHIWDMTTGTVASFETRFSFSIEQPYTRPLPADGLVFFMGPTKSKP-AQGYG-YLGIFNNSKQDNSYQTLGVEFDTFSNP------WDPPQVPHIGIDVNSIRSIKTQPFQLDNGQVANVVIKYDASSKILHAVLVYPSSGAIYTIAEIVDVKQVLPEWVDVGLSGATGAQRDAAETHDVYSWSFQA-----SLPETN 267          
BLAST of FC929468 vs. ExPASy Swiss-Prot
Match: LEC_BOWMI (Lectin OS=Bowringia mildbraedii PE=1 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 5.044e-11
Identity = 70/240 (29.17%), Postives = 107/240 (44.58%), Query Frame = 1
Query:   85 ISFSFPSFAKDSCDNKTLICYG--AIESSGALSITPGPPPNLPIR-KVGRVLYGKPLSLQRSF-----IDTTITIKISRHQNYTDRAGDGMTFIFAS-DKNGPSAKGVGEYLGL---QSSPGDKFPPLAVELDTCLNKNLXXXXXXXXXXXXXXXESNPVNSLLDVDLKSGRAIQVRIYYNPDFGQLSVYAAYSGETLVKVVEKPINLSDIIPTPVYVGFTAATGDFLESHEVINWTFNS 768
            + F+F  F     D   LI  G  ++ S+ AL +T       P    VGR LY  P+ L +S       +TT T  IS+  +    A   +TF  AS D   PS  G G  LGL    ++ G     +AVE DT  N ++                S   +     D ++G+     I YN    +LSV ++Y   + V VV   + L+++ P  V VGF+A TG + +++ ++ W+F S
Sbjct:    4 VCFTFTDFESGQQD---LIFQGDASVGSNKALQLTKVDSKGNPQGGSVGRALYTAPIRLWQSSSLVASFETTFTFSISQGSSTPAAA---LTFFIASPDTKIPSGSG-GRLLGLFGSSNNAGSDNGVVAVEFDTYPNTDIGDPNYRHIGIDVNSIRSKAASKW---DWQNGKTATAHISYNSASKRLSVVSSYPNSSPV-VVSFDVELNNVGPPDVRVGFSATTGQYTQTNNILAWSFRS 232          
The following BLAST results are available for this feature:
BLAST of FC929468 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
LEC2_CLALU2.419e-1329.63Agglutinin-2 OS=Cladrastis lutea PE=1 SV=1[more]
LEC_ERYCG1.734e-1129.05Lectin OS=Erythrina crista-galli PE=1 SV=1[more]
LEC2_CYTSC2.264e-1128.572-acetamido-2-deoxy-D-galactose-binding seed lecti... [more]
LECS_SOPJA3.862e-1128.10Seed lectin OS=Sophora japonica PE=2 SV=1[more]
LEC_ERYCO5.044e-1127.50Lectin OS=Erythrina corallodendron PE=1 SV=3[more]
LEC_BOWMI5.044e-1129.17Lectin OS=Bowringia mildbraedii PE=1 SV=1[more]
back to top
Properties
Property NameValue
Genbank descriptionKN0AAH2CE03RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH2CE03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929468 ID=FC929468|Name=FC929468|organism=Citrus clementina|type=EST|length=828bp
GCAGAACAAAAAATGATTTTCCTACTACTCCTCTCCGTTTTTCTTCGCGG
AGCTTCTTCATCAATCCTTTCCGAAGACACACCTATTAGCTTCTCATTTC
CCTCATTCGCCAAAGACAGTTGTGACAATAAGACCCTCATTTGCTACGGA
GCGATTGAAAGTTCCGGCGCCTTAAGCATCACACCAGGCCCTCCACCAAA
CCTGCCGATCAGAAAGGTTGGACGGGTTTTATACGGCAAGCCTCTGAGTT
TACAGCGATCTTTTATTGATACCACCATCACCATTAAGATCTCACGCCAT
CAGAATTACACTGATCGTGCCGGAGATGGCATGACGTTCATTTTTGCAAG
CGATAAAAACGGTCCATCAGCAAAGGGCGTCGGCGAATATCTTGGACTGC
AGTCTTCACCAGGCGATAAATTTCCTCCATTAGCCGTGGAGCTGGACACA
TGCCTGAACAAGAACCTGAATGATCCAGATGATAACCATATTGGCATCGA
CATAAACGGAATCGAATCAAATCCAGTTAATAGTCTGCTTGACGTTGATC
TCAAAAGTGGACGAGCAATCCAGGTTCGAATTTATTACAATCCAGACTTT
GGACAACTCTCTGTTTATGCGGCATATTCGGGGGAAACACTTGTGAAGGT
GGTTGAAAAACCCATTAACCTGTCAGATATAATTCCAACGCCCGTCTATG
TTGGATTCACAGCAGCTACGGGGGACTTTTTAGAAAGCCATGAGGTTATA
AATTGGACCTTCAACTCGTTCCCAGTGCCGCCTTCTCTCAAGGAGAAAAA
CCTGGTGATGCCAATATAATTCTAAACC
back to top