FC929526

Overview
NameFC929526
Unique NameFC929526
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length626
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15051 contig Ccv1_Contig15051:1..626. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929526 vs. ExPASy Swiss-Prot
Match: ADK1_ARATH (Adenosine kinase 1 OS=Arabidopsis thaliana GN=ADK1 PE=1 SV=1)

HSP 1 Score: 227.254 bits (578), Expect = 5.124e-59
Identity = 107/129 (82.95%), Postives = 120/129 (93.02%), Query Frame = 1
Query:   10 MDYVFGNETEARTFAKVHGWETDNVEEIALKISQWPKASGTHKRITVITQGADPVVVAEDGKVKLFPVILLPKEKLVDTNGAGDAFVGGFLSQLVQEKPVEDCVRTGCYAANVVIQRSGCTYPPKPEFN 396
            MDY+FGNETEARTF++VHGWETD+VE+IA+K+SQ PKASGT+KR TVITQGADPVVVAEDGKVK +PVI LPKEKLVDTNGAGDAFVGGFLSQLV  K +E+CVR GCYA+NVVIQRSGCTYP KP+FN
Sbjct:  216 MDYIFGNETEARTFSRVHGWETDDVEQIAIKMSQLPKASGTYKRTTVITQGADPVVVAEDGKVKKYPVIPLPKEKLVDTNGAGDAFVGGFLSQLVHGKGIEECVRAGCYASNVVIQRSGCTYPEKPDFN 344          
BLAST of FC929526 vs. ExPASy Swiss-Prot
Match: ADK2_ARATH (Adenosine kinase 2 OS=Arabidopsis thaliana GN=ADK2 PE=1 SV=1)

HSP 1 Score: 226.098 bits (575), Expect = 1.141e-58
Identity = 105/129 (81.40%), Postives = 122/129 (94.57%), Query Frame = 1
Query:   10 MDYVFGNETEARTFAKVHGWETDNVEEIALKISQWPKASGTHKRITVITQGADPVVVAEDGKVKLFPVILLPKEKLVDTNGAGDAFVGGFLSQLVQEKPVEDCVRTGCYAANVVIQRSGCTYPPKPEFN 396
            MD+VFGNETEARTF++VHGWET++VE+IA+KISQ PKA+GT+KR TVITQGADPVVVAEDGKVK +PVI LPKEKLVDTNGAGDAFVGGF+SQLV+EK +E+CV+ GCYA+NVVIQRSGCTYP KP+FN
Sbjct:  217 MDFVFGNETEARTFSRVHGWETEDVEQIAIKISQLPKATGTYKRTTVITQGADPVVVAEDGKVKKYPVIPLPKEKLVDTNGAGDAFVGGFMSQLVKEKSIEECVKAGCYASNVVIQRSGCTYPEKPDFN 345          
BLAST of FC929526 vs. ExPASy Swiss-Prot
Match: ADK_PHYPA (Adenosine kinase OS=Physcomitrella patens GN=ADK PE=1 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 4.974e-46
Identity = 85/128 (66.41%), Postives = 104/128 (81.25%), Query Frame = 1
Query:   10 MDYVFGNETEARTFAKVHGWETDNVEEIALKISQWPKASGTHKRITVITQGADPVVVAEDGKVKLFPVILLPKEKLVDTNGAGDAFVGGFLSQLVQEKPVEDCVRTGCYAANVVIQRSGCTYPPKPEF 393
            +D++FGNE+EAR FA+V GWET++ + IA+K++  PKA GTHKR+ VITQG DP +VAEDGKV  FPV  +PKEKLVDTN AGD+FVGGFLSQLV  K +  CVR G YAA+V+IQRSGCT+P KP F
Sbjct:  213 VDFIFGNESEARAFAQVQGWETEDTKVIAVKLAALPKAGGTHKRVAVITQGTDPTIVAEDGKVTEFPVTPIPKEKLVDTNAAGDSFVGGFLSQLVLGKDIAQCVRAGNYAASVIIQRSGCTFPSKPSF 340          
BLAST of FC929526 vs. ExPASy Swiss-Prot
Match: ADK_MOUSE (Adenosine kinase OS=Mus musculus GN=Adk PE=1 SV=2)

HSP 1 Score: 150.599 bits (379), Expect = 6.095e-36
Identity = 68/129 (52.71%), Postives = 96/129 (74.42%), Query Frame = 1
Query:   10 MDYVFGNETEARTFAKVHGWETDNVEEIALKISQWPKASGTHKRITVITQGADPVVVAEDGKVKLFPVILLPKEKLVDTNGAGDAFVGGFLSQLVQEKPVEDCVRTGCYAANVVIQRSGCTYPPKPEFN 396
            +D +FGNETEA TFA+  G+ET +++EIA K    PK +   +R  + TQG D  +VA +  V  FPV+   +E+++DTNGAGDAFVGGFLSQLV +KP+ +C+R G YAA+V+I+R+GCT+P KP+F+
Sbjct:  233 VDILFGNETEAATFAREQGFETKDIKEIAKKAQALPKVNSKRQRTVIFTQGRDDTIVAAENDVTAFPVLDQNQEEIIDTNGAGDAFVGGFLSQLVSDKPLTECIRAGHYAASVIIRRTGCTFPEKPDFH 361          
BLAST of FC929526 vs. ExPASy Swiss-Prot
Match: ADK_RAT (Adenosine kinase OS=Rattus norvegicus GN=Adk PE=1 SV=3)

HSP 1 Score: 149.058 bits (375), Expect = 1.773e-35
Identity = 69/129 (53.49%), Postives = 94/129 (72.87%), Query Frame = 1
Query:   10 MDYVFGNETEARTFAKVHGWETDNVEEIALKISQWPKASGTHKRITVITQGADPVVVAEDGKVKLFPVILLPKEKLVDTNGAGDAFVGGFLSQLVQEKPVEDCVRTGCYAANVVIQRSGCTYPPKPEFN 396
            +D +FGNETEA TFA+  G+ET +++EIA K    PK +   +R  + TQG D  +VA    V  FPV+   +E++VDTNGAGDAFVGGFLSQLV  KP+ +C+R G YAA+V+I+R+GCT+P KP+F+
Sbjct:  233 VDILFGNETEAATFAREQGFETKDIKEIARKTQALPKVNSKRQRTVIFTQGRDDTIVATGNDVTAFPVLDQNQEEIVDTNGAGDAFVGGFLSQLVSNKPLTECIRAGHYAASVIIRRTGCTFPEKPDFH 361          
BLAST of FC929526 vs. ExPASy Swiss-Prot
Match: ADK_HUMAN (Adenosine kinase OS=Homo sapiens GN=ADK PE=1 SV=2)

HSP 1 Score: 147.132 bits (370), Expect = 6.738e-35
Identity = 65/129 (50.39%), Postives = 97/129 (75.19%), Query Frame = 1
Query:   10 MDYVFGNETEARTFAKVHGWETDNVEEIALKISQWPKASGTHKRITVITQGADPVVVAEDGKVKLFPVILLPKEKLVDTNGAGDAFVGGFLSQLVQEKPVEDCVRTGCYAANVVIQRSGCTYPPKPEFN 396
            +D +FGNETEA TFA+  G+ET +++EIA K    PK +   +RI + TQG D  ++A + +V  F V+   +++++DTNGAGDAFVGGFLSQLV +KP+ +C+R G YAA+++I+R+GCT+P KP+F+
Sbjct:  234 VDILFGNETEAATFAREQGFETKDIKEIAKKTQALPKMNSKRQRIVIFTQGRDDTIMATESEVTAFAVLDQDQKEIIDTNGAGDAFVGGFLSQLVSDKPLTECIRAGHYAASIIIRRTGCTFPEKPDFH 362          
BLAST of FC929526 vs. ExPASy Swiss-Prot
Match: ADK_CRIGR (Adenosine kinase OS=Cricetulus griseus GN=ADK PE=1 SV=2)

HSP 1 Score: 142.51 bits (358), Expect = 1.660e-33
Identity = 67/129 (51.94%), Postives = 93/129 (72.09%), Query Frame = 1
Query:   10 MDYVFGNETEARTFAKVHGWETDNVEEIALKISQWPKASGTHKRITVITQGADPVVVAEDGKVKLFPVILLPKEKLVDTNGAGDAFVGGFLSQLVQEKPVEDCVRTGCYAANVVIQRSGCTYPPKPEFN 396
            +D +FGNETEA TFA+  G+ET +++EIA K     K +    R  V TQG D  VVA + +V  F V+   +++++DTNGAGDAFVGGFLSQLV  KP+ +C+R G YAA+V+I+R+GCT+P KP+F+
Sbjct:  233 VDILFGNETEAATFAREQGFETKDIKEIAKKAQALAKVNSKRPRTVVFTQGRDDTVVATENEVMAFAVLDQNQKEIIDTNGAGDAFVGGFLSQLVYNKPLTECIRAGHYAASVIIRRTGCTFPEKPDFH 361          
BLAST of FC929526 vs. ExPASy Swiss-Prot
Match: ADK_SCHPO (Adenosine kinase OS=Schizosaccharomyces pombe GN=ado1 PE=2 SV=2)

HSP 1 Score: 108.997 bits (271), Expect = 2.034e-23
Identity = 57/128 (44.53%), Postives = 81/128 (63.28%), Query Frame = 1
Query:   13 DYVFGNETEARTFAKVHGWETDNVEEIALKISQWPKASGTHKRITVITQGADPVVVAEDGKVKLFPVILLPKEKLVDTNGAGDAFVGGFLSQLVQEKPVEDCVRTGCYAANVVIQRSGCTYP-PKPEF 393
            DYV GNE E  ++ + HG ++ +V+EIAL +S   K +    R+ VITQGAD  +VA+DGKV  +    +P E++VDTNGAGDAF GGF++ L Q + ++  V  G +     I+ SG T P PK +F
Sbjct:  210 DYVIGNEAEILSYGENHGIKSTDVQEIALALSSVEKVNKKRTRVVVITQGADATIVAKDGKVTTYKPNRVPSEEIVDTNGAGDAFAGGFIAALSQGQGIDYAVTLGHWLGQECIKVSGTTLPLPKKQF 337          
BLAST of FC929526 vs. ExPASy Swiss-Prot
Match: ADK_DICDI (Adenosine kinase OS=Dictyostelium discoideum GN=adk PE=3 SV=2)

HSP 1 Score: 85.1149 bits (209), Expect = 3.145e-16
Identity = 47/131 (35.88%), Postives = 72/131 (54.96%), Query Frame = 1
Query:   10 MDYVFGNETEARTFAKVHGWETDNVEEIALKISQWPKASGTHKRITVITQGADPVVVAEDGKVKLFPVILLPKEKLVDTNGAGDAFVGGFLSQLVQEKPVEDCVRTGCYAANVVIQRSGCTYP---PKPEF 393
            +D VF NE+EA T  +   W  D +  IA K++ W K +    R  V TQG D  +V ++G +  +  I +  E ++D N AGD+F GGFL+     + +  CV  G YA+  +I+++G T P   PK +F
Sbjct:  211 VDIVFANESEAATLGRKMNWGED-LTVIAEKLAAWEKVNTKRTRTVVFTQGPDATLVFQNGVLTKYNPIKVATEDILDLNAAGDSFCGGFLAAYSNGQEIAKCVEAGHYASWEIIRQNGATVPASEPKIQF 340          
BLAST of FC929526 vs. ExPASy Swiss-Prot
Match: ADK_SCHCO (Adenosine kinase OS=Schizophyllum commune GN=ADK PE=2 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.561e-15
Identity = 47/123 (38.21%), Postives = 69/123 (56.10%), Query Frame = 1
Query:   10 MDYVFGNETEARTFAKVHGWETD-NVEEIALKISQWPKASGTHKRITVITQGADPVVV---AEDGKVKLFPVILLPKEKLVDTNGAGDAFVGGFLSQLVQEKPVEDCVRTGCYAANVVIQRSG 366
            +D V  NE+EA  +A   G     ++  +A  ++  PK +    R+ + T GA+  VV   AE G+V+ F V  L + ++VDTNGAGDAF GGFL  LV  + ++D V  G   A + IQ+ G
Sbjct:  211 VDIVIANESEAEAWASASGHPAPTDLAAVAKSLAMQPKTNPARPRVVIFTHGAEETVVVNSAEPGRVRTFKVDKLAEGEIVDTNGAGDAFAGGFLGALVAGRELDDSVEAGHKLAKISIQQIG 333          
The following BLAST results are available for this feature:
BLAST of FC929526 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 12
Match NameE-valueIdentityDescription
ADK1_ARATH5.124e-5982.95Adenosine kinase 1 OS=Arabidopsis thaliana GN=ADK1... [more]
ADK2_ARATH1.141e-5881.40Adenosine kinase 2 OS=Arabidopsis thaliana GN=ADK2... [more]
ADK_PHYPA4.974e-4666.41Adenosine kinase OS=Physcomitrella patens GN=ADK P... [more]
ADK_MOUSE6.095e-3652.71Adenosine kinase OS=Mus musculus GN=Adk PE=1 SV=2[more]
ADK_RAT1.773e-3553.49Adenosine kinase OS=Rattus norvegicus GN=Adk PE=1 ... [more]
ADK_HUMAN6.738e-3550.39Adenosine kinase OS=Homo sapiens GN=ADK PE=1 SV=2[more]
ADK_CRIGR1.660e-3351.94Adenosine kinase OS=Cricetulus griseus GN=ADK PE=1... [more]
ADK_SCHPO2.034e-2344.53Adenosine kinase OS=Schizosaccharomyces pombe GN=a... [more]
ADK_DICDI3.145e-1635.88Adenosine kinase OS=Dictyostelium discoideum GN=ad... [more]
ADK_SCHCO1.561e-1538.21Adenosine kinase OS=Schizophyllum commune GN=ADK P... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH1AB09RM2 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH1AB09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929526 ID=FC929526|Name=FC929526|organism=Citrus clementina|type=EST|length=626bp
GGCACGAGGATGGACTATGTGTTTGGAAATGAGACTGAAGCTAGGACCTT
CGCAAAGGTTCATGGCTGGGAGACTGACAATGTCGAGGAGATTGCTCTGA
AGATTTCTCAGTGGCCCAAGGCATCAGGAACACACAAGAGGATCACTGTT
ATCACTCAAGGTGCTGACCCTGTTGTGGTTGCTGAAGATGGGAAGGTGAA
ATTATTCCCTGTGATCTTGCTACCCAAGGAAAAATTGGTTGATACTAATG
GAGCAGGGGATGCATTTGTCGGAGGATTTTTGTCACAGTTGGTTCAAGAG
AAGCCAGTGGAAGATTGTGTGAGAACTGGTTGCTATGCGGCAAATGTTGT
AATCCAAAGGTCAGGCTGCACTTACCCCCCAAAACCTGAATTCAATTAGG
CTGATTCCTCATTGCAAGAATCTCTTGCGGCCTCTGCTATTGTCAGTTTT
CTTCCGCTGTTTCTTCATTTTTCGAACTTGATTAAAGGGGCCTGTATTAT
TTAATCTAGGAGTTATTTCAATGTTGAATTTGTTTGTGATACTCTGTCCA
CCATGTGGATAAGAATTTGTGACATTTACTTACAGAGGGAATGCATTTTC
CATTTAAATAAAAAAAAAAAAAAAAA
back to top