FC929529

Overview
NameFC929529
Unique NameFC929529
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length852
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC929529_ssr137 microsatellite FC929529_ssr137:137..148. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig9267 contig Ccv1_Contig9267:2..852. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929529 vs. ExPASy Swiss-Prot
Match: PIP24_ARATH (Probable aquaporin PIP2-4 OS=Arabidopsis thaliana GN=PIP2-4 PE=1 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 4.751e-63
Identity = 61/64 (95.31%), Postives = 62/64 (96.88%), Query Frame = -2
Query:  639 KAFQKSYYNRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLP 830
            KAFQ SYY RYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLP
Sbjct:  144 KAFQSSYYTRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLP 207          

HSP 2 Score: 121.709 bits (304), Expect = 4.751e-63
Identity = 57/63 (90.48%), Postives = 58/63 (92.06%), Query Frame = -1
Query:  409 PITGTGINPARSFGAAVIYNKEKAWDDQWIFWVGPFIGAFVAAFYHQYILRAAAIKALGSFRS 597
            PITGTGINPARSFGAAVIYN EKAWDDQWIFWVGP IGA  AAFYHQ+ILRAAAIKALGSF S
Sbjct:  221 PITGTGINPARSFGAAVIYNNEKAWDDQWIFWVGPMIGAAAAAFYHQFILRAAAIKALGSFGS 283          

HSP 3 Score: 34.6538 bits (78), Expect = 4.751e-63
Identity = 15/15 (100.00%), Postives = 15/15 (100.00%), Query Frame = -3
Query:  596 PIGFAVFMVHLATIP 640
            PIGFAVFMVHLATIP
Sbjct:  207 PIGFAVFMVHLATIP 221          
BLAST of FC929529 vs. ExPASy Swiss-Prot
Match: PIP27_MAIZE (Aquaporin PIP2-7 OS=Zea mays GN=PIP2-7 PE=2 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 5.486e-61
Identity = 54/65 (83.08%), Postives = 60/65 (92.31%), Query Frame = -1
Query:  403 PITGTGINPARSFGAAVIYNKEKAWDDQWIFWVGPFIGAFVAAFYHQYILRAAAIKALGSFRSNA 597
            P+TGTGINPARSFG AVI+N +KAWDDQWI+WVGPF+GA VAA YHQYILR +AIKALGSFRSNA
Sbjct:  223 PVTGTGINPARSFGPAVIFNNDKAWDDQWIYWVGPFVGAAVAAIYHQYILRGSAIKALGSFRSNA 287          

HSP 2 Score: 120.939 bits (302), Expect = 5.486e-61
Identity = 56/64 (87.50%), Postives = 60/64 (93.75%), Query Frame = -2
Query:  639 KAFQKSYYNRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLP 830
            K FQKS+YNRYGGG N ++DGYNKGT LGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLP
Sbjct:  146 KGFQKSFYNRYGGGVNTVSDGYNKGTALGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLP 209          

HSP 3 Score: 34.6538 bits (78), Expect = 5.486e-61
Identity = 15/15 (100.00%), Postives = 15/15 (100.00%), Query Frame = -3
Query:  596 PIGFAVFMVHLATIP 640
            PIGFAVFMVHLATIP
Sbjct:  209 PIGFAVFMVHLATIP 223          
BLAST of FC929529 vs. ExPASy Swiss-Prot
Match: PIP21_MAIZE (Aquaporin PIP2-1 OS=Zea mays GN=PIP2-1 PE=1 SV=2)

HSP 1 Score: 123.25 bits (308), Expect = 1.210e-60
Identity = 55/65 (84.62%), Postives = 59/65 (90.77%), Query Frame = -1
Query:  403 PITGTGINPARSFGAAVIYNKEKAWDDQWIFWVGPFIGAFVAAFYHQYILRAAAIKALGSFRSNA 597
            P+TGTGINPARS GAAVIYNK+K WDD WIFWVGP +GA +AAFYHQYILRA AIKALGSFRSNA
Sbjct:  226 PVTGTGINPARSLGAAVIYNKDKPWDDHWIFWVGPLVGAAIAAFYHQYILRAGAIKALGSFRSNA 290          

HSP 2 Score: 118.627 bits (296), Expect = 1.210e-60
Identity = 55/64 (85.94%), Postives = 61/64 (95.31%), Query Frame = -2
Query:  639 KAFQKSYYNRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLP 830
            KAFQ +Y++RYGGGAN LA GY++GTGLGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLP
Sbjct:  149 KAFQSAYFDRYGGGANSLASGYSRGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLP 212          

HSP 3 Score: 34.6538 bits (78), Expect = 1.210e-60
Identity = 15/15 (100.00%), Postives = 15/15 (100.00%), Query Frame = -3
Query:  596 PIGFAVFMVHLATIP 640
            PIGFAVFMVHLATIP
Sbjct:  212 PIGFAVFMVHLATIP 226          
BLAST of FC929529 vs. ExPASy Swiss-Prot
Match: PIP27_ARATH (Aquaporin PIP2-7 OS=Arabidopsis thaliana GN=PIP2-7 PE=1 SV=2)

HSP 1 Score: 127.872 bits (320), Expect = 2.053e-60
Identity = 59/65 (90.77%), Postives = 61/65 (93.85%), Query Frame = -1
Query:  403 PITGTGINPARSFGAAVIYNKEKAWDDQWIFWVGPFIGAFVAAFYHQYILRAAAIKALGSFRSNA 597
            PITGTGINPARSFGAAVIYN EKAWDDQWIFWVGPF+GA  AA YHQYILRA+AIKALGSFRSNA
Sbjct:  214 PITGTGINPARSFGAAVIYNNEKAWDDQWIFWVGPFLGALAAAAYHQYILRASAIKALGSFRSNA 278          

HSP 2 Score: 113.235 bits (282), Expect = 2.053e-60
Identity = 54/64 (84.38%), Postives = 58/64 (90.62%), Query Frame = -2
Query:  639 KAFQKSYYNRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLP 830
            KAF K+ YN  GGGAN +ADGY+KGT LGAEIIGTFVLVYTVFSATDPKRSARDSH+PVLAPLP
Sbjct:  137 KAFMKTPYNTLGGGANTVADGYSKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLP 200          

HSP 3 Score: 34.6538 bits (78), Expect = 2.053e-60
Identity = 15/15 (100.00%), Postives = 15/15 (100.00%), Query Frame = -3
Query:  596 PIGFAVFMVHLATIP 640
            PIGFAVFMVHLATIP
Sbjct:  200 PIGFAVFMVHLATIP 214          
BLAST of FC929529 vs. ExPASy Swiss-Prot
Match: PIP21_ORYSJ (Probable aquaporin PIP2-1 OS=Oryza sativa subsp. japonica GN=PIP2-1 PE=2 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 7.667e-60
Identity = 55/65 (84.62%), Postives = 59/65 (90.77%), Query Frame = -1
Query:  403 PITGTGINPARSFGAAVIYNKEKAWDDQWIFWVGPFIGAFVAAFYHQYILRAAAIKALGSFRSNA 597
            PITGTGINPARS GAAVI+N EKAW + WIFWVGPF+GA +AAFYHQYILRA AIKALGSFRSNA
Sbjct:  226 PITGTGINPARSIGAAVIFNNEKAWHNHWIFWVGPFVGAAIAAFYHQYILRAGAIKALGSFRSNA 290          

HSP 2 Score: 118.242 bits (295), Expect = 7.667e-60
Identity = 56/64 (87.50%), Postives = 60/64 (93.75%), Query Frame = -2
Query:  639 KAFQKSYYNRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLP 830
            KAFQ +Y+NRYGGGAN LA GY+KGTGL AEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLP
Sbjct:  149 KAFQSAYFNRYGGGANTLAAGYSKGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLP 212          

HSP 3 Score: 34.6538 bits (78), Expect = 7.667e-60
Identity = 15/15 (100.00%), Postives = 15/15 (100.00%), Query Frame = -3
Query:  596 PIGFAVFMVHLATIP 640
            PIGFAVFMVHLATIP
Sbjct:  212 PIGFAVFMVHLATIP 226          
BLAST of FC929529 vs. ExPASy Swiss-Prot
Match: PIP22_MAIZE (Aquaporin PIP2-2 OS=Zea mays GN=PIP2-2 PE=2 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 9.981e-60
Identity = 54/65 (83.08%), Postives = 59/65 (90.77%), Query Frame = -1
Query:  403 PITGTGINPARSFGAAVIYNKEKAWDDQWIFWVGPFIGAFVAAFYHQYILRAAAIKALGSFRSNA 597
            P+TGTGINPARS GAAV+YNK+K WDD WIFWVGP +GA +AAFYHQYILRA AIKALGSFRSNA
Sbjct:  228 PVTGTGINPARSLGAAVVYNKDKPWDDHWIFWVGPLLGAAIAAFYHQYILRAGAIKALGSFRSNA 292          

HSP 2 Score: 116.316 bits (290), Expect = 9.981e-60
Identity = 53/64 (82.81%), Postives = 60/64 (93.75%), Query Frame = -2
Query:  639 KAFQKSYYNRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLP 830
            KAFQ +Y++RYGGGAN LA GY++G GLGAEI+GTFVLVYTVFSATDPKR+ARDSHVPVLAPLP
Sbjct:  151 KAFQSAYFDRYGGGANSLASGYSRGAGLGAEIVGTFVLVYTVFSATDPKRNARDSHVPVLAPLP 214          

HSP 3 Score: 34.6538 bits (78), Expect = 9.981e-60
Identity = 15/15 (100.00%), Postives = 15/15 (100.00%), Query Frame = -3
Query:  596 PIGFAVFMVHLATIP 640
            PIGFAVFMVHLATIP
Sbjct:  214 PIGFAVFMVHLATIP 228          
BLAST of FC929529 vs. ExPASy Swiss-Prot
Match: PIP22_ORYSJ (Probable aquaporin PIP2-2 OS=Oryza sativa subsp. japonica GN=PIP2-2 PE=2 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 4.858e-59
Identity = 57/64 (89.06%), Postives = 61/64 (95.31%), Query Frame = -2
Query:  639 KAFQKSYYNRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLP 830
            K FQ SYY RYGGGANEL+DGY+KGTGLGAEIIGTFVLVYTVFSATDPKR+ARDSH+PVLAPLP
Sbjct:  148 KGFQSSYYARYGGGANELSDGYSKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHIPVLAPLP 211          

HSP 2 Score: 114.005 bits (284), Expect = 4.858e-59
Identity = 53/65 (81.54%), Postives = 58/65 (89.23%), Query Frame = -1
Query:  403 PITGTGINPARSFGAAVIYNKEKAWDDQWIFWVGPFIGAFVAAFYHQYILRAAAIKALGSFRSNA 597
            PITGTGINPARS G AVIYNK+KAWDDQWIFWVGP IGA +AA YHQY+LRA+A K LGS+RSNA
Sbjct:  225 PITGTGINPARSLGTAVIYNKDKAWDDQWIFWVGPLIGAAIAAAYHQYVLRASAAK-LGSYRSNA 288          

HSP 3 Score: 34.6538 bits (78), Expect = 4.858e-59
Identity = 15/15 (100.00%), Postives = 15/15 (100.00%), Query Frame = -3
Query:  596 PIGFAVFMVHLATIP 640
            PIGFAVFMVHLATIP
Sbjct:  211 PIGFAVFMVHLATIP 225          
BLAST of FC929529 vs. ExPASy Swiss-Prot
Match: PIP24_MAIZE (Aquaporin PIP2-4 OS=Zea mays GN=PIP2-4 PE=1 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 8.231e-59
Identity = 57/64 (89.06%), Postives = 60/64 (93.75%), Query Frame = -2
Query:  639 KAFQKSYYNRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLP 830
            K FQ +YY RYGGGANEL+DGY+KGTGL AEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLP
Sbjct:  148 KGFQSAYYVRYGGGANELSDGYSKGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLP 211          

HSP 2 Score: 115.546 bits (288), Expect = 8.231e-59
Identity = 54/65 (83.08%), Postives = 59/65 (90.77%), Query Frame = -1
Query:  403 PITGTGINPARSFGAAVIYNKEKAWDDQWIFWVGPFIGAFVAAFYHQYILRAAAIKALGSFRSNA 597
            PITGTGINPARS GAAVIYNK+KAWDDQWIFWVGP IGA +AA YHQY+LRA+A K LGS+RSNA
Sbjct:  225 PITGTGINPARSLGAAVIYNKDKAWDDQWIFWVGPLIGAAIAAAYHQYVLRASATK-LGSYRSNA 288          

HSP 3 Score: 34.6538 bits (78), Expect = 8.231e-59
Identity = 15/15 (100.00%), Postives = 15/15 (100.00%), Query Frame = -3
Query:  596 PIGFAVFMVHLATIP 640
            PIGFAVFMVHLATIP
Sbjct:  211 PIGFAVFMVHLATIP 225          
BLAST of FC929529 vs. ExPASy Swiss-Prot
Match: PIP23_MAIZE (Aquaporin PIP2-3 OS=Zea mays GN=PIP2-3 PE=2 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 8.231e-59
Identity = 57/64 (89.06%), Postives = 60/64 (93.75%), Query Frame = -2
Query:  639 KAFQKSYYNRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLP 830
            K FQ +YY RYGGGANEL+DGY+KGTGL AEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLP
Sbjct:  149 KGFQSAYYVRYGGGANELSDGYSKGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLP 212          

HSP 2 Score: 115.546 bits (288), Expect = 8.231e-59
Identity = 54/65 (83.08%), Postives = 59/65 (90.77%), Query Frame = -1
Query:  403 PITGTGINPARSFGAAVIYNKEKAWDDQWIFWVGPFIGAFVAAFYHQYILRAAAIKALGSFRSNA 597
            PITGTGINPARS GAAVIYNK+KAWDDQWIFWVGP IGA +AA YHQY+LRA+A K LGS+RSNA
Sbjct:  226 PITGTGINPARSLGAAVIYNKDKAWDDQWIFWVGPLIGAAIAAAYHQYVLRASATK-LGSYRSNA 289          

HSP 3 Score: 34.6538 bits (78), Expect = 8.231e-59
Identity = 15/15 (100.00%), Postives = 15/15 (100.00%), Query Frame = -3
Query:  596 PIGFAVFMVHLATIP 640
            PIGFAVFMVHLATIP
Sbjct:  212 PIGFAVFMVHLATIP 226          
BLAST of FC929529 vs. ExPASy Swiss-Prot
Match: PIP26_ARATH (Probable aquaporin PIP2-6 OS=Arabidopsis thaliana GN=PIP2-6 PE=1 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 1.071e-58
Identity = 52/63 (82.54%), Postives = 58/63 (92.06%), Query Frame = -1
Query:  409 PITGTGINPARSFGAAVIYNKEKAWDDQWIFWVGPFIGAFVAAFYHQYILRAAAIKALGSFRS 597
            PITGTGINPARSFGAAVIYN +KAWDDQWIFWVGPF+GA +AAFYHQ++LRA A+KA GS RS
Sbjct:  220 PITGTGINPARSFGAAVIYNNQKAWDDQWIFWVGPFVGAAIAAFYHQFVLRAGAMKAYGSVRS 282          

HSP 2 Score: 117.857 bits (294), Expect = 1.071e-58
Identity = 54/64 (84.38%), Postives = 59/64 (92.19%), Query Frame = -2
Query:  639 KAFQKSYYNRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLP 830
            K FQ +YYNRYGGGAN L+DGYN G G+GAEIIGTFVLVYTVFSATDPKR+ARDSH+PVLAPLP
Sbjct:  143 KVFQSTYYNRYGGGANMLSDGYNVGVGVGAEIIGTFVLVYTVFSATDPKRNARDSHIPVLAPLP 206          

HSP 3 Score: 33.4982 bits (75), Expect = 1.071e-58
Identity = 14/15 (93.33%), Postives = 15/15 (100.00%), Query Frame = -3
Query:  596 PIGFAVFMVHLATIP 640
            PIGF+VFMVHLATIP
Sbjct:  206 PIGFSVFMVHLATIP 220          
The following BLAST results are available for this feature:
BLAST of FC929529 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 51
Match NameE-valueIdentityDescription
PIP24_ARATH4.751e-6395.31Probable aquaporin PIP2-4 OS=Arabidopsis thaliana ... [more]
PIP27_MAIZE5.486e-6183.08Aquaporin PIP2-7 OS=Zea mays GN=PIP2-7 PE=2 SV=1[more]
PIP21_MAIZE1.210e-6084.62Aquaporin PIP2-1 OS=Zea mays GN=PIP2-1 PE=1 SV=2[more]
PIP27_ARATH2.053e-6090.77Aquaporin PIP2-7 OS=Arabidopsis thaliana GN=PIP2-7... [more]
PIP21_ORYSJ7.667e-6084.62Probable aquaporin PIP2-1 OS=Oryza sativa subsp. j... [more]
PIP22_MAIZE9.981e-6083.08Aquaporin PIP2-2 OS=Zea mays GN=PIP2-2 PE=2 SV=1[more]
PIP22_ORYSJ4.858e-5989.06Probable aquaporin PIP2-2 OS=Oryza sativa subsp. j... [more]
PIP24_MAIZE8.231e-5989.06Aquaporin PIP2-4 OS=Zea mays GN=PIP2-4 PE=1 SV=1[more]
PIP23_MAIZE8.231e-5989.06Aquaporin PIP2-3 OS=Zea mays GN=PIP2-3 PE=2 SV=1[more]
PIP26_ARATH1.071e-5882.54Probable aquaporin PIP2-6 OS=Arabidopsis thaliana ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH1AB12RM2 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH1AB12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929529 ID=FC929529|Name=FC929529|organism=Citrus clementina|type=EST|length=852bp
TTTTTTTTTACAAAAAGGTCATAGTTTTATTCACTAGAGTTGGGGATTAA
TTAACATTAACAACATAAATACACCACTTGAAATAAAGAAAAAGGAAAGG
ATAAGAAAAATATAGAGAAATAGGATATATAAAAAACACCACCACCACTT
ATAAACACACCCAAAGAAAAAAATTAAAATGGGATACCAAAATCCACCCT
TACACATAGATAAAGCATAGGCATAAAATGCATAATGTTCAAATATCTAC
AATTCAATAGCCCTCTAATTCAGCTCAAATTCAATGGCCCTCTAAAGAGC
TTGAAAAGAGATTTCTTAAAGGGCCTTCGTAACAGACTTGCACTCCTGAT
CATGCTGTAAATTTTTCACCTTGGAAGCACCAGACATCATATTTAAAGCT
TAAGCATTGCTCCTGAAGGATCCAAGAGCCTTAATGGCTGCTGCCCTGAG
AATGTATTGGTGGTAGAATGCAGCAACGAAAGCTCCAATGAATGGTCCAA
CCCAGAAGATCCATTGGTCATCCCAGGCTTTCTCCTTGTTGTAGATCACA
GCAGCTCCAAAACTCCTAGCTGGGTTGATGCCGGTTCCGGTGATGGGGGA
TGGTGGCCAAGTGAACCATGAACACAGCAAACCCAATGGGGGAGTGGTGC
CAAGACCGGAACATGGGAGTCTCTTGCGCTCCTCTTAGGATCAGTGGCAG
AGAAAACAGTGTAGACAAGAACGAAAGTACCGATGATCTCAGCACCCAGT
CCGGTGCCCTTGTTGTATCCATCAGCTAGCTCATTGGCCCCACCTCCATA
CCTGTTGTAGTATGATTTTTGGAAAGCCTTCCAAACCCACACCACAGATT
GC
back to top