FC929533

Overview
NameFC929533
Unique NameFC929533
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length626
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15018 contig Ccv1_Contig15018:1..626. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929533 vs. ExPASy Swiss-Prot
Match: H4_SILLA (Histone H4 OS=Silene latifolia GN=SlH4 PE=3 SV=3)

HSP 1 Score: 162.54 bits (410), Expect = 1.550e-39
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  140 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG 385
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of FC929533 vs. ExPASy Swiss-Prot
Match: H4_PEA (Histone H4 OS=Pisum sativum PE=1 SV=2)

HSP 1 Score: 162.54 bits (410), Expect = 1.550e-39
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  140 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG 385
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of FC929533 vs. ExPASy Swiss-Prot
Match: H4_MAIZE (Histone H4 OS=Zea mays GN=H4C7 PE=1 SV=2)

HSP 1 Score: 162.54 bits (410), Expect = 1.550e-39
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  140 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG 385
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of FC929533 vs. ExPASy Swiss-Prot
Match: H4_LOLTE (Histone H4 OS=Lolium temulentum PE=3 SV=2)

HSP 1 Score: 162.54 bits (410), Expect = 1.550e-39
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  140 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG 385
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of FC929533 vs. ExPASy Swiss-Prot
Match: H4_FLATR (Histone H4 OS=Flaveria trinervia GN=hh4 PE=3 SV=3)

HSP 1 Score: 162.54 bits (410), Expect = 1.550e-39
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  140 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG 385
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of FC929533 vs. ExPASy Swiss-Prot
Match: H4_EUCGL (Histone H4 OS=Eucalyptus globulus PE=3 SV=3)

HSP 1 Score: 162.54 bits (410), Expect = 1.550e-39
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  140 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG 385
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of FC929533 vs. ExPASy Swiss-Prot
Match: H4_CHEMJ (Histone H4 OS=Chelidonium majus PE=3 SV=3)

HSP 1 Score: 162.54 bits (410), Expect = 1.550e-39
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  140 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG 385
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of FC929533 vs. ExPASy Swiss-Prot
Match: H4_ARATH (Histone H4 OS=Arabidopsis thaliana GN=At1g07660 PE=1 SV=2)

HSP 1 Score: 162.54 bits (410), Expect = 1.550e-39
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  140 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG 385
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of FC929533 vs. ExPASy Swiss-Prot
Match: H42_WHEAT (Histone H4 variant TH091 OS=Triticum aestivum PE=3 SV=2)

HSP 1 Score: 162.54 bits (410), Expect = 1.550e-39
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  140 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG 385
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of FC929533 vs. ExPASy Swiss-Prot
Match: H41_WHEAT (Histone H4 variant TH011 OS=Triticum aestivum PE=3 SV=2)

HSP 1 Score: 162.54 bits (410), Expect = 1.550e-39
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  140 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG 385
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG 103          
The following BLAST results are available for this feature:
BLAST of FC929533 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 108
Match NameE-valueIdentityDescription
H4_SILLA1.550e-39100.00Histone H4 OS=Silene latifolia GN=SlH4 PE=3 SV=3[more]
H4_PEA1.550e-39100.00Histone H4 OS=Pisum sativum PE=1 SV=2[more]
H4_MAIZE1.550e-39100.00Histone H4 OS=Zea mays GN=H4C7 PE=1 SV=2[more]
H4_LOLTE1.550e-39100.00Histone H4 OS=Lolium temulentum PE=3 SV=2[more]
H4_FLATR1.550e-39100.00Histone H4 OS=Flaveria trinervia GN=hh4 PE=3 SV=3[more]
H4_EUCGL1.550e-39100.00Histone H4 OS=Eucalyptus globulus PE=3 SV=3[more]
H4_CHEMJ1.550e-39100.00Histone H4 OS=Chelidonium majus PE=3 SV=3[more]
H4_ARATH1.550e-39100.00Histone H4 OS=Arabidopsis thaliana GN=At1g07660 PE... [more]
H42_WHEAT1.550e-39100.00Histone H4 variant TH091 OS=Triticum aestivum PE=3... [more]
H41_WHEAT1.550e-39100.00Histone H4 variant TH011 OS=Triticum aestivum PE=3... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH1AC04RM2 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH1AC04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929533 ID=FC929533; Name=FC929533; organism=Citrus clementina; type=EST; length=626bp
GGCACGAGGCAAAAAAGTAAAATTGTCACGAATCACTCTGATTTATTCAT
CAGACACGCAATATCAGAGAAAAATTATGTCGGGGCGTGGGAAGGGAGGC
AAGGGGTTGGGAAAGGGAGGAGCAAAGCGTCACCGTAAGGTTCTTCGCGA
TAACATTCAGGGAATCACAAAGCCCGCAATCCGGCGTCTGGCTCGTCGGG
GTGGGGTGAAGCGTATCAGTGGGTTGATCTACGAGGAGACACGTGGCGTT
CTGAAGATCTTTTTGGAGAACGTCATCCGCGACGCCGTGACTTACACTGA
GCACGCTCGGAGGAAGACTGTGACGGCGATGGACGTCGTGTACGCGCTCA
AGAGGCAGGGCAGGACTCTCTATGGGTTTGGTGGTTAAAGAAGTTGGTAT
CGCTTGTTTGTGATGGTTGTAAAGAGAGAAGTCTTGCTGTCAAGAAGCTT
TTGTGGTTCTGTTTCTAGGGTTAGGACTTGTGCGTTTTCTTTCTGGTTAA
ATGGGAATCTTGGTTTAATTTGTTAATGGTGTTTTCATTTTGTAACGTTA
ATTACCCCTATGATTTTGAGTAGAATTAACGATAGATCGTTGTGAAGCTT
CTTGGTATAAAAAAAAAAAAAAAAAA
back to top