FC929655
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FC929655 vs. ExPASy Swiss-Prot
Match: PSB1_PETHY (Proteasome subunit beta type-1 OS=Petunia hybrida GN=PBF1 PE=2 SV=1) HSP 1 Score: 77.7962 bits (190), Expect = 1.889e-14 Identity = 43/57 (75.44%), Postives = 45/57 (78.95%), Query Frame = 3 Query: 6 YRVIAAYTLMSTRYRILTHHYSKIS*LAHKCVMASSGFHADVKALQKLLASRDLIYQ 176 Y VIAA T MST Y ILT YSKI LA KCVMASSGF ADV+ALQK+LASR LIYQ Sbjct: 26 YCVIAADTRMSTGYNILTRDYSKIIKLADKCVMASSGFQADVRALQKVLASRHLIYQ 82
BLAST of FC929655 vs. ExPASy Swiss-Prot
Match: PSB1_ARATH (Proteasome subunit beta type-1 OS=Arabidopsis thaliana GN=PBF1 PE=1 SV=2) HSP 1 Score: 68.5514 bits (166), Expect = 1.146e-11 Identity = 38/57 (66.67%), Postives = 43/57 (75.44%), Query Frame = 3 Query: 6 YRVIAAYTLMSTRYRILTHHYSKIS*LAHKCVMASSGFHADVKALQKLLASRDLIYQ 176 Y VIAA T MST Y IL+ YSKI LA + V++SSGF ADVKALQK+L SR LIYQ Sbjct: 26 YCVIAADTRMSTGYSILSRDYSKIHKLADRAVLSSSGFQADVKALQKVLKSRHLIYQ 82 The following BLAST results are available for this feature:
BLAST of FC929655 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 2
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FC929655 ID=FC929655; Name=FC929655; organism=Citrus clementina; type=EST; length=178bpback to top |