FC930181

Overview
NameFC930181
Unique NameFC930181
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length672
Libraries
Library NameType
PostHarvC1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC930181 vs. ExPASy Swiss-Prot
Match: THI4_CITSI (Thiazole biosynthetic enzyme, chloroplastic OS=Citrus sinensis GN=THI1 PE=2 SV=1)

HSP 1 Score: 367.466 bits (942), Expect = 3.620e-101
Identity = 187/193 (96.89%), Postives = 187/193 (96.89%), Query Frame = 3
Query:   93 MAAMTSTAFAPSVSSTTNKLFDSSFHGAPMSPSLLRLQPIKSSRPNNLSISASASPPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYELSKNPNIQIAIIEQPVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNAVA 671
            MAAM STAFAPSVSSTTNKLFDSSFHGAPMSPSLLRLQPIKSSRPNNLSISASASPPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTD    GAGSAGLSCAYELSKNPNIQIAIIEQ VSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNAVA
Sbjct:    1 MAAMASTAFAPSVSSTTNKLFDSSFHGAPMSPSLLRLQPIKSSRPNNLSISASASPPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNAVA 193          
BLAST of FC930181 vs. ExPASy Swiss-Prot
Match: THI4_ALNGL (Thiazole biosynthetic enzyme, chloroplastic OS=Alnus glutinosa GN=THI4 PE=2 SV=1)

HSP 1 Score: 271.552 bits (693), Expect = 2.703e-72
Identity = 134/171 (78.36%), Postives = 150/171 (87.72%), Query Frame = 3
Query:  159 SSFHGAPMSPSLLRLQPIKSSRPNNLSISASASPPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYELSKNPNIQIAIIEQPVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNAVA 671
            SSF+G P++PS +R+QP K+    ++S+S + SPPYDL  F FDPIKESIVSREMTRRYM DMITYADTD    GAGS+GL C YELSKNP++Q+AIIEQ VSPGGGAWLGGQLFS MVVRKPAH+FLDELGI+YDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNAVA
Sbjct:   20 SSFYGTPLAPSSIRVQPTKAGAKPSISMSGAPSPPYDLKAFTFDPIKESIVSREMTRRYMMDMITYADTDVVVVGAGSSGLVC-YELSKNPSVQVAIIEQSVSPGGGAWLGGQLFSGMVVRKPAHLFLDELGIEYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNAVA 189          
BLAST of FC930181 vs. ExPASy Swiss-Prot
Match: THI4_ARATH (Thiazole biosynthetic enzyme, chloroplastic OS=Arabidopsis thaliana GN=THI1 PE=1 SV=1)

HSP 1 Score: 263.462 bits (672), Expect = 7.361e-70
Identity = 138/194 (71.13%), Postives = 160/194 (82.47%), Query Frame = 3
Query:   93 MAAMTSTAFAPSVSSTT-NKLFDSSFHGAPMSPSLLRLQPIKSSRPNNLSISASASPPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYELSKNPNIQIAIIEQPVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNAVA 671
            MAA+ ST    S+SST   +LFDSSFHG+ +S + + +      +P + S+ A+ +  YDLN F FDPIKESIVSREMTRRYMTDMITYA+TD    GAGSAGLS AYE+SKNPN+Q+AIIEQ VSPGGGAWLGGQLFSAM+VRKPAH+FLDE+G+ YDEQD YVV+KHAALFTSTIMSKLLARPNVKLFNAVA
Sbjct:    1 MAAIASTL---SLSSTKPQRLFDSSFHGSAISAAPISI----GLKPRSFSVRATTAG-YDLNAFTFDPIKESIVSREMTRRYMTDMITYAETDVVVVGAGSAGLSAAYEISKNPNVQVAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEIGVAYDEQDTYVVVKHAALFTSTIMSKLLARPNVKLFNAVA 186          
BLAST of FC930181 vs. ExPASy Swiss-Prot
Match: THI41_MAIZE (Thiazole biosynthetic enzyme 1-1, chloroplastic OS=Zea mays GN=THI1-1 PE=2 SV=1)

HSP 1 Score: 242.662 bits (618), Expect = 1.345e-63
Identity = 129/191 (67.54%), Postives = 148/191 (77.49%), Query Frame = 3
Query:  132 SSTTNKLFDSSFHGAPMSPSLLRLQPIK----------SSRPNNLSISASAS-PPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYELSKNPNIQIAIIEQPVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNAVA 671
            ++  + L  SSF G+ + P+  R  P             + P   S+S S+S PPYDL +F+F PIKESIVSREMTRRYMTDMITYADTD    GAGSAGLSCAYELSK+P + IAI+EQ VSPGGGAWLGGQLFSAMVVRKPAH+FLDELG+ YDE ++YVVIKHAALFTST+MS LLARPNVKLFNAVA
Sbjct:    3 TAAASSLLKSSFAGSRL-PAATRTTPASLVVATGPRGAGAGPICASMSMSSSNPPYDLTSFRFSPIKESIVSREMTRRYMTDMITYADTDVVIVGAGSAGLSCAYELSKDPAVSIAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGVAYDEAEDYVVIKHAALFTSTVMSLLLARPNVKLFNAVA 192          
BLAST of FC930181 vs. ExPASy Swiss-Prot
Match: THI42_MAIZE (Thiazole biosynthetic enzyme 1-2, chloroplastic OS=Zea mays GN=THI1-2 PE=2 SV=1)

HSP 1 Score: 242.276 bits (617), Expect = 1.756e-63
Identity = 126/189 (66.67%), Postives = 147/189 (77.78%), Query Frame = 3
Query:  132 SSTTNKLFDSSFHGAPMSPSLLRLQ---------PIKSSRPNNLSISASASPPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYELSKNPNIQIAIIEQPVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNAVA 671
            ++  + L  SSF G+ + PS  R           P     P   SIS S +PPYDL +F+F PIKESIVSREMTRRYMTDMIT+ADTD    GAGSAGLSCAYELSK+P + +AI+EQ VSPGGGAWLGGQLFSAMVVR+PAH+FLDELG+ YDE ++YVV+KHAALFTST+MS+LLARPNVKLFNAVA
Sbjct:    3 TTAASSLLKSSFAGSRL-PSATRTTTPSSVAVATPRAGGGPIRASIS-SPNPPYDLTSFRFSPIKESIVSREMTRRYMTDMITHADTDVVIVGAGSAGLSCAYELSKDPTVSVAIVEQSVSPGGGAWLGGQLFSAMVVRRPAHLFLDELGVGYDEAEDYVVVKHAALFTSTVMSRLLARPNVKLFNAVA 189          
BLAST of FC930181 vs. ExPASy Swiss-Prot
Match: THI2_SCHPO (Thiazole biosynthetic enzyme, mitochondrial OS=Schizosaccharomyces pombe GN=thi2 PE=2 SV=2)

HSP 1 Score: 178.333 bits (451), Expect = 3.114e-44
Identity = 88/144 (61.11%), Postives = 116/144 (80.56%), Query Frame = 3
Query:  246 ASASPPYDLN-TFKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYEL-SKNPNIQIAIIEQPVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNAVA 671
            + A P Y L+ +F F PI+ES VSR MTRRY +D+  YA++D    GAGSAGL+ AY + ++ P+++IAIIE  V+PGGGAWLGGQLFSAMVVRKPA +FL+E+G+ Y+++ +YVV+KHAALFTST+M++ LA PNVKLFNA A
Sbjct:   37 SKAYPTYSLDESFSFAPIRESTVSRAMTRRYFSDLDKYAESDIVIVGAGSAGLTAAYYIGTRRPDLKIAIIEASVAPGGGAWLGGQLFSAMVVRKPADLFLNEIGVPYEDEGDYVVVKHAALFTSTVMARTLALPNVKLFNATA 180          
BLAST of FC930181 vs. ExPASy Swiss-Prot
Match: THI4_FUSOX (Thiazole biosynthetic enzyme, mitochondrial OS=Fusarium oxysporum GN=STI35 PE=2 SV=2)

HSP 1 Score: 174.866 bits (442), Expect = 3.443e-43
Identity = 87/130 (66.92%), Postives = 104/130 (80.00%), Query Frame = 3
Query:  279 FKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYELSKN-PNIQIAIIEQPVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNA 665
            FKF PI+ES VSR MTRRY  D+  YA++D    GAGS GLS AY L K  P+++IAIIE  VSPGGGAWLGGQLFSAM++RKPA  FL E+G+ Y+++ NYVV+KHAALFTSTIMSK+L  PN+KLFNA
Sbjct:   44 FKFAPIRESQVSRAMTRRYFQDLDNYAESDIVIIGAGSCGLSAAYILGKKRPDLKIAIIEASVSPGGGAWLGGQLFSAMIMRKPADAFLREVGVPYEDEGNYVVVKHAALFTSTIMSKVLQMPNIKLFNA 173          
BLAST of FC930181 vs. ExPASy Swiss-Prot
Match: THI4_ASPOR (Thiazole biosynthetic enzyme, mitochondrial OS=Aspergillus oryzae GN=thiA PE=3 SV=2)

HSP 1 Score: 173.326 bits (438), Expect = 1.002e-42
Identity = 88/134 (65.67%), Postives = 108/134 (80.60%), Query Frame = 3
Query:  279 FKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYELSK-NPNIQIAIIEQPVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDE--QDNYVVIKHAALFTSTIMSKLLARPNVKLFNAVA 671
            FKF PI+ES VSR MTRRY  D+  YA++D    GAGS GLS AY L+K  P+++IAI+E  VSPGGGAWLGGQLFSAMV+R+PA +FL+ELG+ Y+E    NYVV+KHA+LFTST+MSK+L+ PNVKLFNA A
Sbjct:   48 FKFAPIRESQVSRAMTRRYFEDLDKYAESDVVIVGAGSCGLSTAYVLAKARPDLKIAIVEASVSPGGGAWLGGQLFSAMVMRRPAEVFLNELGVPYEEDANPNYVVVKHASLFTSTLMSKVLSFPNVKLFNATA 181          
BLAST of FC930181 vs. ExPASy Swiss-Prot
Match: THI4_UROFA (Thiazole biosynthetic enzyme, mitochondrial OS=Uromyces fabae GN=THI2 PE=3 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 2.915e-42
Identity = 87/161 (54.04%), Postives = 114/161 (70.81%), Query Frame = 3
Query:  201 LQPIKSSRPNNLSISASA---SPPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYEL-SKNPNIQIAIIEQPVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNAVA 671
            + P+KS + +N +++  A    P  +L   KF PIKE  V R M RRY  DM   A +D    GAGSAGLSCAY L +  P+++I I+E  V+PGGG WLGGQL SAMV RKPA  FLD++G+ Y+++ N+VV+KHAALFTST++SK+LA PNVK+FNA A
Sbjct:   24 MDPLKSKQQSNATVNKPAFKPEPAVNLTPIKFAPIKEHQVQRAMVRRYFQDMEERAISDVIIVGAGSAGLSCAYALGTARPDLKITILESNVAPGGGCWLGGQLMSAMVCRKPADEFLDQVGVPYEDEGNFVVVKHAALFTSTVLSKVLAMPNVKMFNATA 184          
BLAST of FC930181 vs. ExPASy Swiss-Prot
Match: THI4_FUSSH (Thiazole biosynthetic enzyme, mitochondrial OS=Fusarium solani subsp. phaseoli GN=STI35 PE=2 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 4.972e-42
Identity = 87/130 (66.92%), Postives = 102/130 (78.46%), Query Frame = 3
Query:  279 FKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYELSKN-PNIQIAIIEQPVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNA 665
            FKF PI+ES VSR MTRRY  D+  YA++D    GAGS GLS  Y L K  P+++IAIIE  VSPGGGAWLGGQLFSAMV+RKPA  FL E+G+ Y+++ NYVV+KHAALFTSTIMSK+L  PN KLFNA
Sbjct:   48 FKFAPIRESQVSRAMTRRYFQDLDNYAESDIVIVGAGSCGLSTRYILGKKRPDLKIAIIEASVSPGGGAWLGGQLFSAMVMRKPADAFLREVGVPYEDEGNYVVVKHAALFTSTIMSKVLQLPNCKLFNA 177          
The following BLAST results are available for this feature:
BLAST of FC930181 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 19
Match NameE-valueIdentityDescription
THI4_CITSI3.620e-10196.89Thiazole biosynthetic enzyme, chloroplastic OS=Cit... [more]
THI4_ALNGL2.703e-7278.36Thiazole biosynthetic enzyme, chloroplastic OS=Aln... [more]
THI4_ARATH7.361e-7071.13Thiazole biosynthetic enzyme, chloroplastic OS=Ara... [more]
THI41_MAIZE1.345e-6367.54Thiazole biosynthetic enzyme 1-1, chloroplastic OS... [more]
THI42_MAIZE1.756e-6366.67Thiazole biosynthetic enzyme 1-2, chloroplastic OS... [more]
THI2_SCHPO3.114e-4461.11Thiazole biosynthetic enzyme, mitochondrial OS=Sch... [more]
THI4_FUSOX3.443e-4366.92Thiazole biosynthetic enzyme, mitochondrial OS=Fus... [more]
THI4_ASPOR1.002e-4265.67Thiazole biosynthetic enzyme, mitochondrial OS=Asp... [more]
THI4_UROFA2.915e-4254.04Thiazole biosynthetic enzyme, mitochondrial OS=Uro... [more]
THI4_FUSSH4.972e-4266.92Thiazole biosynthetic enzyme, mitochondrial OS=Fus... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34004F06EF PostHarvC1 Citrus clementina cDNA clone C34004F06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC930181 ID=FC930181; Name=FC930181; organism=Citrus clementina; type=EST; length=672bp
GTCACCAGTCATCATCACTGCTGCAAATCAAATTACTTCTCATTATCAAA
CTTCTAAGCAGCAGGGGAAGGAGGGGTTAAAAAAAAAAAAACATGGCAGC
CATGACTTCTACAGCTTTCGCTCCTTCAGTTTCGTCCACCACCAATAAGC
TCTTTGACTCATCCTTTCATGGGGCTCCCATGTCACCTTCTCTTCTACGT
CTTCAACCCATCAAATCTTCTCGTCCCAACAACTTGTCCATTTCTGCTTC
TGCTTCTCCTCCTTATGACTTGAACACTTTCAAGTTTGACCCCATCAAAG
AATCCATTGTTTCTCGTGAAATGACACGCAGGTACATGACGGACATGATC
ACTTATGCTGACACTGATGTGGTAGTGGTTGGTGCTGGCTCTGCTGGCCT
CTCTTGTGCTTATGAGCTCAGCAAAAACCCCAACATTCAGATTGCTATTA
TCGAACAGCCTGTTAGCCCCGGCGGTGGCGCGTGGCTCGGTGGACAGCTC
TTCTCTGCCATGGTTGTGCGCAAACCAGCCCACATCTTCCTTGACGAGCT
TGGCATCGACTACGATGAGCAAGACAACTATGTTGTGATCAAGCATGCAG
CGCTGTTCACCTCCACTATAATGAGCAAGCTCCTGGCCCGCCCCAACGTC
AAGCTCTTTAATGCAGTGGCAG
back to top