FC930548

Overview
NameFC930548
Unique NameFC930548
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length693
Libraries
Library NameType
PostHarvC1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC930548 vs. ExPASy Swiss-Prot
Match: PIMT_WHEAT (Protein-L-isoaspartate O-methyltransferase OS=Triticum aestivum GN=PCM PE=1 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 8.167e-49
Identity = 85/134 (63.43%), Postives = 106/134 (79.10%), Query Frame = 2
Query:  290 KVSEVMETIDRACFVPDGTPPYVDSPMAIGYNATISAPHMHATCLQLLEENLKPGMHALDIGSGTGYLTACFALMVGPQGRAVGVEHIPELVASSIQNIEKKCSGSIAERRFSLSACW*WKKGWPEFAPL*CIH 691
            KV+EVMETIDRA FVP+G  PY DSPM IGYNATISAPHMHATCL+LL++ L+PGMHALD+GSG+GYLTACFA+MVGP+GRAVG+EHIPELV +S +N+E+  + ++ +           + GWP+ AP   IH
Sbjct:   30 KVAEVMETIDRALFVPEGFTPYTDSPMPIGYNATISAPHMHATCLELLKDYLQPGMHALDVGSGSGYLTACFAMMVGPEGRAVGIEHIPELVVASTENVERSAAAALMKDGSLSFHVSDGRLGWPDAAPYDAIH 163          

HSP 2 Score: 33.8834 bits (76), Expect = 8.167e-49
Identity = 12/30 (40.00%), Postives = 21/30 (70.00%), Query Frame = 1
Query:  202 MERYWSGSGVNKNKAMVEHLQHYGVITSKK 291
            M ++W+   + KN A+VE+L+ YGV+ + K
Sbjct:    1 MAQFWAEGSLEKNNALVEYLKQYGVVRTDK 30          
BLAST of FC930548 vs. ExPASy Swiss-Prot
Match: PIMT_ARATH (Protein-L-isoaspartate O-methyltransferase OS=Arabidopsis thaliana GN=PCM PE=2 SV=3)

HSP 1 Score: 168.703 bits (426), Expect = 3.072e-48
Identity = 81/134 (60.45%), Postives = 99/134 (73.88%), Query Frame = 2
Query:  290 KVSEVMETIDRACFVPDGTPPYVDSPMAIGYNATISAPHMHATCLQLLEENLKPGMHALDIGSGTGYLTACFALMVGPQGRAVGVEHIPELVASSIQNIEKKCSGSIAERRFSLSACW*WKKGWPEFAPL*CIH 691
            +V++ ME +DR  FV D +  YVDSPM+IGYN TISAPHMHA CLQLLE++LKPGM  LD+GSGTGYLTACFA+MVG +GRA+GVEHIPELVASS++NIE   +    +           ++GW EFAP   IH
Sbjct:   30 EVAKAMEAVDRGVFVTDRSSAYVDSPMSIGYNVTISAPHMHAMCLQLLEKHLKPGMRVLDVGSGTGYLTACFAVMVGTEGRAIGVEHIPELVASSVKNIEASAASPFLKEGSLAVHVGDGRQGWAEFAPYDAIH 163          

HSP 2 Score: 44.669 bits (104), Expect = 3.072e-48
Identity = 17/28 (60.71%), Postives = 26/28 (92.86%), Query Frame = 1
Query:  202 MERYWSGSGVNKNKAMVEHLQHYGVITS 285
            M+++WS S +NKNKAMVE+LQ++G++TS
Sbjct:    1 MKQFWSPSSINKNKAMVENLQNHGIVTS 28          
BLAST of FC930548 vs. ExPASy Swiss-Prot
Match: PIMT_BOVIN (Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Bos taurus GN=PCMT1 PE=1 SV=2)

HSP 1 Score: 114.775 bits (286), Expect = 3.432e-26
Identity = 57/101 (56.44%), Postives = 71/101 (70.30%), Query Frame = 2
Query:  290 KVSEVMETIDRACFVPDGTPPYVDSPMAIGYNATISAPHMHATCLQLLEENLKPGMHALDIGSGTGYLTACFALMVGPQGRAVGVEHIPELVASSIQNIEK 592
            KV EVM   DR+ +      PY+DSP +IG+ ATISAPHMHA  L+LL + L  G  ALD+GSG+G LTACFA MVGP G+ +G++HI ELV  SI N+ K
Sbjct:   27 KVFEVMLATDRSHYAKCN--PYMDSPQSIGFQATISAPHMHAYALELLFDQLNEGAKALDVGSGSGILTACFARMVGPSGKVIGIDHIKELVDDSINNVRK 125          

HSP 2 Score: 24.6386 bits (52), Expect = 3.432e-26
Identity = 12/26 (46.15%), Postives = 15/26 (57.69%), Query Frame = 3
Query:  609 LLKEGSLSVHVGDGRKVGQSLLPYDA 686
            LL  G + + VGDGR    +  PYDA
Sbjct:  130 LLSSGRVQLVVGDGRMGYAAEAPYDA 155          
BLAST of FC930548 vs. ExPASy Swiss-Prot
Match: PIMT_CHICK (Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Gallus gallus GN=PCMT1 PE=2 SV=3)

HSP 1 Score: 117.087 bits (292), Expect = 9.063e-26
Identity = 65/134 (48.51%), Postives = 84/134 (62.69%), Query Frame = 2
Query:  290 KVSEVMETIDRACFVPDGTPPYVDSPMAIGYNATISAPHMHATCLQLLEENLKPGMHALDIGSGTGYLTACFALMVGPQGRAVGVEHIPELVASSIQNIEKKCSGSIAERRFSLSACW*WKKGWPEFAPL*CIH 691
            KV EVM   DR  +      PY+DSP +IG+ ATISAPHMHA  L+LL + L  G  ALD+GSG+G LTACF+ MVGP+G+ VG++HI ELV  SI N++K     ++  R  L      + G+ E AP   IH
Sbjct:   27 KVFEVMLATDRCHYAKYN--PYMDSPQSIGFQATISAPHMHAYALELLSDQLHEGAKALDVGSGSGILTACFSRMVGPKGQVVGIDHIKELVDDSINNVKKDDPTLLSSGRVKL-IVGDGRMGYAEEAPYDAIH 157          
BLAST of FC930548 vs. ExPASy Swiss-Prot
Match: PIMT_PIG (Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Sus scrofa GN=PCMT1 PE=1 SV=3)

HSP 1 Score: 116.701 bits (291), Expect = 1.184e-25
Identity = 65/134 (48.51%), Postives = 83/134 (61.94%), Query Frame = 2
Query:  290 KVSEVMETIDRACFVPDGTPPYVDSPMAIGYNATISAPHMHATCLQLLEENLKPGMHALDIGSGTGYLTACFALMVGPQGRAVGVEHIPELVASSIQNIEKKCSGSIAERRFSLSACW*WKKGWPEFAPL*CIH 691
            KV EVM   DR+ +      PY+DSP +IG+ ATISAPHMHA  L+LL + L  G  ALD+GSG+G LTACFA MVGP G+ +G++HI ELV  SI N+ K     ++  R  L      + G+ E AP   IH
Sbjct:   27 KVFEVMLATDRSHYAKCN--PYMDSPQSIGFQATISAPHMHAYALELLFDQLHEGAKALDVGSGSGILTACFARMVGPSGKVIGIDHIKELVDDSINNVRKDDPMLLSSGRVQL-VVGDGRMGYAEEAPYDAIH 157          
BLAST of FC930548 vs. ExPASy Swiss-Prot
Match: PIMT_DANRE (Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Danio rerio GN=pcmt PE=2 SV=3)

HSP 1 Score: 115.931 bits (289), Expect = 2.019e-25
Identity = 64/134 (47.76%), Postives = 83/134 (61.94%), Query Frame = 2
Query:  290 KVSEVMETIDRACFVPDGTPPYVDSPMAIGYNATISAPHMHATCLQLLEENLKPGMHALDIGSGTGYLTACFALMVGPQGRAVGVEHIPELVASSIQNIEKKCSGSIAERRFSLSACW*WKKGWPEFAPL*CIH 691
            +V EVM   DR+ F      PY+DSP +IGY ATISAPHMHA  L+LL ++L  G  ALD+GSG+G L+ CF+ MVGP G+ +G++HI ELV  SI N++K     I   R  L      + G+ E AP   IH
Sbjct:   27 RVYEVMLATDRSHF--SRCNPYMDSPQSIGYQATISAPHMHAYALELLHDHLYEGAKALDVGSGSGILSVCFSRMVGPTGKVIGIDHIKELVEDSIANVKKDDPSLITSGRIKL-IVGDGRMGFTEEAPYDAIH 157          
BLAST of FC930548 vs. ExPASy Swiss-Prot
Match: PIMT_CAEEL (Protein-L-isoaspartate O-methyltransferase OS=Caenorhabditis elegans GN=pcm-1 PE=2 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 2.637e-25
Identity = 62/135 (45.93%), Postives = 84/135 (62.22%), Query Frame = 2
Query:  287 KKVSEVMETIDRACFVPDGTPPYVDSPMAIGYNATISAPHMHATCLQLLEENLKPGMHALDIGSGTGYLTACFALMVGPQGRAVGVEHIPELVASSIQNIEKKCSGSIAERRFSLSACW*WKKGWPEFAPL*CIH 691
            ++  + M+++DR  F P    PY D+P  IGYNAT+SAPHMHA  L  L+ +L  G  ALD+GSG+GYLT C A+MVG  G  VG+EH+P+LV  S +NI K  S  + ER   +      ++G+ E AP   IH
Sbjct:   26 QRAYDAMKSVDRGDFAPRA--PYEDAPQRIGYNATVSAPHMHAAALDYLQNHLVAGAKALDVGSGSGYLTVCMAMMVGRNGTVVGIEHMPQLVELSEKNIRKHHSEQL-ERGNVIIIEGDGRQGFAEKAPYNAIH 157          
BLAST of FC930548 vs. ExPASy Swiss-Prot
Match: PIMT_MOUSE (Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Mus musculus GN=Pcmt1 PE=1 SV=3)

HSP 1 Score: 114.005 bits (284), Expect = 7.672e-25
Identity = 64/134 (47.76%), Postives = 83/134 (61.94%), Query Frame = 2
Query:  290 KVSEVMETIDRACFVPDGTPPYVDSPMAIGYNATISAPHMHATCLQLLEENLKPGMHALDIGSGTGYLTACFALMVGPQGRAVGVEHIPELVASSIQNIEKKCSGSIAERRFSLSACW*WKKGWPEFAPL*CIH 691
            KV EVM   DR+ +      PY+DSP +IG+ ATISAPHMHA  L+LL + L  G  ALD+GSG+G LTACFA MVG  G+ +G++HI ELV  SI N++K     ++  R  L      + G+ E AP   IH
Sbjct:   27 KVFEVMLATDRSHYAKSN--PYMDSPQSIGFQATISAPHMHAYALELLFDQLHEGAKALDVGSGSGILTACFARMVGNSGKVIGIDHIKELVDDSITNVKKDDPMLLSSGRVRL-VVGDGRMGYAEEAPYDAIH 157          
BLAST of FC930548 vs. ExPASy Swiss-Prot
Match: PIMT_RAT (Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Rattus norvegicus GN=Pcmt1 PE=1 SV=2)

HSP 1 Score: 113.62 bits (283), Expect = 1.002e-24
Identity = 64/134 (47.76%), Postives = 83/134 (61.94%), Query Frame = 2
Query:  290 KVSEVMETIDRACFVPDGTPPYVDSPMAIGYNATISAPHMHATCLQLLEENLKPGMHALDIGSGTGYLTACFALMVGPQGRAVGVEHIPELVASSIQNIEKKCSGSIAERRFSLSACW*WKKGWPEFAPL*CIH 691
            KV EVM   DR+ +      PY+DSP +IG+ ATISAPHMHA  L+LL + L  G  ALD+GSG+G LTACFA MVG  G+ +G++HI ELV  SI N++K     ++  R  L      + G+ E AP   IH
Sbjct:   27 KVFEVMLATDRSHYAKSN--PYMDSPQSIGFQATISAPHMHAYALELLFDQLHEGAKALDVGSGSGILTACFARMVGHSGKVIGIDHIKELVDDSITNVKKDDPMLLSSGRVRL-VVGDGRMGFAEEAPYDAIH 157          
BLAST of FC930548 vs. ExPASy Swiss-Prot
Match: PIMT_PONAB (Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Pongo abelii GN=PCMT1 PE=2 SV=3)

HSP 1 Score: 112.849 bits (281), Expect = 1.709e-24
Identity = 64/134 (47.76%), Postives = 82/134 (61.19%), Query Frame = 2
Query:  290 KVSEVMETIDRACFVPDGTPPYVDSPMAIGYNATISAPHMHATCLQLLEENLKPGMHALDIGSGTGYLTACFALMVGPQGRAVGVEHIPELVASSIQNIEKKCSGSIAERRFSLSACW*WKKGWPEFAPL*CIH 691
            KV EVM   DR+ +      PY+DSP +IG+ ATISAPHMHA  L+LL + L  G  ALD+GSG+G LTACFA MVG  G+ +G++HI ELV  SI N+ K     ++  R  L      + G+ E AP   IH
Sbjct:   27 KVFEVMLATDRSHYAKCN--PYMDSPQSIGFQATISAPHMHAYALELLFDQLHEGAKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSINNVRKDDPTLLSSGRVQL-VVGDGRMGYAEEAPYDAIH 157          
The following BLAST results are available for this feature:
BLAST of FC930548 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 28
Match NameE-valueIdentityDescription
PIMT_WHEAT8.167e-4963.43Protein-L-isoaspartate O-methyltransferase OS=Trit... [more]
PIMT_ARATH3.072e-4860.45Protein-L-isoaspartate O-methyltransferase OS=Arab... [more]
PIMT_BOVIN3.432e-2656.44Protein-L-isoaspartate(D-aspartate) O-methyltransf... [more]
PIMT_CHICK9.063e-2648.51Protein-L-isoaspartate(D-aspartate) O-methyltransf... [more]
PIMT_PIG1.184e-2548.51Protein-L-isoaspartate(D-aspartate) O-methyltransf... [more]
PIMT_DANRE2.019e-2547.76Protein-L-isoaspartate(D-aspartate) O-methyltransf... [more]
PIMT_CAEEL2.637e-2545.93Protein-L-isoaspartate O-methyltransferase OS=Caen... [more]
PIMT_MOUSE7.672e-2547.76Protein-L-isoaspartate(D-aspartate) O-methyltransf... [more]
PIMT_RAT1.002e-2447.76Protein-L-isoaspartate(D-aspartate) O-methyltransf... [more]
PIMT_PONAB1.709e-2447.76Protein-L-isoaspartate(D-aspartate) O-methyltransf... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34008G02EF PostHarvC1 Citrus clementina cDNA clone C34008G02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC930548 ID=FC930548; Name=FC930548; organism=Citrus clementina; type=EST; length=693bp
GGATAGCGTATGGTTTCCGCTATTATTATAGTGCCTGGTTTAAAGCACAT
ATTATCAACCTTCACTCTTATCCCTCACCGTCATCGCTGTTCTTACTTAC
CATCACCGTCACCGTCACTTGTCTCTTTGTCTTCTTCTTTTCATCTTCCA
AATCCAGATAACCTCAGTCGTTTCCTCACGGGTAACTGTCCCTTTTTCAA
GATGGAGCGATACTGGAGTGGAAGTGGTGTCAACAAGAATAAAGCGATGG
TGGAGCATTTGCAGCATTATGGAGTGATTACATCAAAAAAAGGTATCTGA
AGTAATGGAAACTATTGATCGGGCTTGCTTTGTGCCAGATGGTACTCCAC
CTTATGTTGACAGCCCAATGGCAATAGGTTACAATGCCACTATTTCAGCA
CCTCATATGCATGCAACATGCCTTCAATTATTGGAGGAGAATCTGAAACC
TGGCATGCACGCTTTGGATATTGGTTCTGGAACTGGATATTTGACAGCAT
GCTTTGCCTTGATGGTTGGACCACAAGGTCGTGCTGTGGGTGTCGAGCAC
ATTCCTGAGTTGGTGGCTTCATCAATCCAGAATATTGAAAAAAAGTGCAG
CGGCTCCATTGCTGAAAGAAGGTTCTCTCTCAGTGCATGTTGGTGATGGA
AGAAAGGTTGGCCAGAGTTTGCTCCCCTATGATGCATACATGT
back to top