FC930778

Overview
NameFC930778
Unique NameFC930778
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length736
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15214 contig Ccv1_Contig15214:1..736. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC930778 vs. ExPASy Swiss-Prot
Match: NACA1_ARATH (Nascent polypeptide-associated complex subunit alpha-like protein 1 OS=Arabidopsis thaliana GN=At3g12390 PE=1 SV=1)

HSP 1 Score: 208.764 bits (530), Expect = 2.552e-53
Identity = 114/136 (83.82%), Postives = 120/136 (88.24%), Query Frame = 1
Query:  289 AMLKLGMKPIPGVSRVTVKKSKNILFVISKPDVFKSPTSDTYIVFGEAKIEDLSSQLQTQAAEQFKVPPPNTGNVASKPESS--AMVQDDEEVDETGVEPKDIELVMTQAGVPRSRAVKALXAADGDIVSAIMELT 690
            AMLKLGMKPI GVSRVTVKKSKNILFVISKPDVFKSP SDTY++FGEAKIEDLSSQ+Q+QAAEQFK   P+  NV SK ESS  A+VQDDEEVDE GVEPKDIELVMTQAGV R  AVKAL AADGDIVSAIMELT
Sbjct:   69 AMLKLGMKPITGVSRVTVKKSKNILFVISKPDVFKSPASDTYVIFGEAKIEDLSSQIQSQAAEQFKA--PDLSNVISKGESSSAAVVQDDEEVDEEGVEPKDIELVMTQAGVSRPNAVKALKAADGDIVSAIMELT 202          
BLAST of FC930778 vs. ExPASy Swiss-Prot
Match: NACA_PINTA (Nascent polypeptide-associated complex subunit alpha-like protein OS=Pinus taeda PE=2 SV=1)

HSP 1 Score: 207.994 bits (528), Expect = 4.353e-53
Identity = 111/135 (82.22%), Postives = 119/135 (88.15%), Query Frame = 1
Query:  289 AMLKLGMKPIPGVSRVTVKKSKNILFVISKPDVFKSPTSDTYIVFGEAKIEDLSSQLQTQAAEQFKVPPPNTGNVASKPESSAMVQDDE-EVDETGVEPKDIELVMTQAGVPRSRAVKALXAADGDIVSAIMELT 690
            AMLKLGMKP+ GVSRVT+KKSKNILFVIS PDVFKSPTSDTYI FGEAKIEDLSSQLQTQAAEQFK   PN  +V  KPESS   Q+DE EVD+TGVEPKDIELVMTQAGV R++AVKAL AADGDIVSAIM+LT
Sbjct:   72 AMLKLGMKPVSGVSRVTIKKSKNILFVISNPDVFKSPTSDTYIAFGEAKIEDLSSQLQTQAAEQFKA--PNLSHVTMKPESSTAAQEDEDEVDDTGVEPKDIELVMTQAGVSRTKAVKALKAADGDIVSAIMDLT 204          
BLAST of FC930778 vs. ExPASy Swiss-Prot
Match: NACA3_ARATH (Nascent polypeptide-associated complex subunit alpha-like protein 3 OS=Arabidopsis thaliana GN=At5g13850 PE=1 SV=1)

HSP 1 Score: 198.749 bits (504), Expect = 2.641e-50
Identity = 112/141 (79.43%), Postives = 119/141 (84.40%), Query Frame = 1
Query:  289 AMLKLGMKPIPGVSRVTVKKSKNILFVISKPDVFKSPTSDTYIVFGEAKIEDLSSQLQTQAAEQFKVPPPNTGNVASKPESS-----AMVQ--DDEEVDETGVEPKDIELVMTQAGVPRSRAVKALXAADGDIVSAIMELT 690
            AMLKLGMKPI GVSRVTVKKSKNILFVISKPDVFKSP SDTY++FGEAKIEDLSSQLQ+QAAEQFK   PN  NV S+ E+S     A VQ  DDEEVDE GVEPKDIELVMTQAGV + RAVKAL  A+GDIVSAIMELT
Sbjct:   65 AMLKLGMKPITGVSRVTVKKSKNILFVISKPDVFKSPASDTYVIFGEAKIEDLSSQLQSQAAEQFKA--PNLSNVISQGETSSAATAAAVQDDDDEEVDEEGVEPKDIELVMTQAGVSKPRAVKALKLANGDIVSAIMELT 203          
BLAST of FC930778 vs. ExPASy Swiss-Prot
Match: NACA2_ARATH (Nascent polypeptide-associated complex subunit alpha-like protein 2 OS=Arabidopsis thaliana GN=At3g49470 PE=2 SV=2)

HSP 1 Score: 183.726 bits (465), Expect = 8.791e-46
Identity = 95/140 (67.86%), Postives = 117/140 (83.57%), Query Frame = 1
Query:  289 AMLKLGMKPIPGVSRVTVKKSKNILFVISKPDVFKSPTSDTYIVFGEAKIEDLSSQLQTQAAEQFKVPPPNTGNVASKPESSA------MVQDDEEVDETGVEPKDIELVMTQAGVPRSRAVKALXAADGDIVSAIMELT 690
            AMLKLGMKP+ GVSRVT+K++KN+LF ISKPDVFKSP S+TY++FGEAKIEDLSSQLQTQAA+QF++  P  G  + + E+S       + +D+EE+DETGVE +DI+LVMTQAGV RS+AVKAL + DGDIVSAIMELT
Sbjct:   79 AMLKLGMKPVTGVSRVTIKRTKNVLFFISKPDVFKSPHSETYVIFGEAKIEDLSSQLQTQAAQQFRM--PEIGATSQRAEASTATVEAQVEEDEEEIDETGVEARDIDLVMTQAGVSRSKAVKALKSHDGDIVSAIMELT 216          
BLAST of FC930778 vs. ExPASy Swiss-Prot
Match: NACA4_ARATH (Nascent polypeptide-associated complex subunit alpha-like protein 4 OS=Arabidopsis thaliana GN=At4g10480 PE=2 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 4.824e-44
Identity = 95/140 (67.86%), Postives = 115/140 (82.14%), Query Frame = 1
Query:  289 AMLKLGMKPIPGVSRVTVKKSKNILFVISKPDVFKSPTSDTYIVFGEAKIEDLSSQLQTQAAEQFKVPP-----PNT-GNVASKPESSAMVQDDEEVDETGVEPKDIELVMTQAGVPRSRAVKALXAADGDIVSAIMELT 690
            AMLKLGMKP+  VSRVT+K+SKN+LFVISKPDVFKSP S+TY++FGEAKI+D+SSQLQ QAA++FK+P      PNT G+ A+        +DDE+VDETGVE KDI+LVMTQAGV R +AVKAL  ++GDIVSAIMELT
Sbjct:   74 AMLKLGMKPVTDVSRVTIKRSKNVLFVISKPDVFKSPNSETYVIFGEAKIDDMSSQLQAQAAQRFKMPDVASMIPNTDGSEAATVAQEE--EDDEDVDETGVEAKDIDLVMTQAGVSRPKAVKALKESNGDIVSAIMELT 211          
BLAST of FC930778 vs. ExPASy Swiss-Prot
Match: NACA5_ARATH (Nascent polypeptide-associated complex subunit alpha-like protein 5 OS=Arabidopsis thaliana GN=At1g33040 PE=2 SV=2)

HSP 1 Score: 173.711 bits (439), Expect = 9.097e-43
Identity = 88/139 (63.31%), Postives = 116/139 (83.45%), Query Frame = 1
Query:  289 AMLKLGMKPIPGVSRVTVKKSKNILFVISKPDVFKSPTSDTYIVFGEAKIEDLSSQLQTQAAEQFKVPP-----PNTGNVASKPESSAMVQDDEEVDETGVEPKDIELVMTQAGVPRSRAVKALXAADGDIVSAIMELT 690
            A+LKLGMKP+  VSRVT+K++KN+LFVISKPDV+KSP ++TY++FGEAK++DLSSQLQTQAA++FK+P      PN G+ A+     A  +D+++VD+TGVE +DI+LVMTQAGV +++AV AL A DGDIVSAIMELT
Sbjct:   71 AVLKLGMKPVSDVSRVTIKRAKNVLFVISKPDVYKSPNAETYVIFGEAKVDDLSSQLQTQAAQRFKMPDVTSMLPNAGSEATM-APLAEEEDEDDVDDTGVEARDIDLVMTQAGVSKAKAVSALKANDGDIVSAIMELT 208          
BLAST of FC930778 vs. ExPASy Swiss-Prot
Match: NACA_ORENI (Nascent polypeptide-associated complex subunit alpha OS=Oreochromis niloticus GN=naca PE=2 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 5.519e-40
Identity = 86/136 (63.24%), Postives = 107/136 (78.68%), Query Frame = 1
Query:  289 AMLKLGMKPIPGVSRVTVKKSKNILFVISKPDVFKSPTSDTYIVFGEAKIEDLSSQLQTQAAEQFKVPPPNTGNVASKPESSAMVQ--DDEEVDETGVEPKDIELVMTQAGVPRSRAVKALXAADGDIVSAIMELT 690
            AM KLG++ + GV+RVT++KSKNILFVI+KPDV+KSP SDTYIVFGEAKIEDLS Q Q  AAE+FKVP     NV    ++  + +  ++EEVDETGVE KDIELVM+QA V R++AV+AL   + DIV+AIMELT
Sbjct:   79 AMSKLGLRQVTGVTRVTIRKSKNILFVITKPDVYKSPASDTYIVFGEAKIEDLSQQAQLAAAEKFKVPGETVSNVQENTQTPTVQEESEEEEVDETGVEVKDIELVMSQANVSRAKAVRALKNNNNDIVNAIMELT 214          
BLAST of FC930778 vs. ExPASy Swiss-Prot
Match: NACA_DANRE (Nascent polypeptide-associated complex subunit alpha OS=Danio rerio GN=naca PE=1 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 1.041e-38
Identity = 84/136 (61.76%), Postives = 106/136 (77.94%), Query Frame = 1
Query:  289 AMLKLGMKPIPGVSRVTVKKSKNILFVISKPDVFKSPTSDTYIVFGEAKIEDLSSQLQTQAAEQFKVPPPNTGNVASKPESSAMVQ--DDEEVDETGVEPKDIELVMTQAGVPRSRAVKALXAADGDIVSAIMELT 690
            AM KLG++ + GV+RVT++KSKNILFVI+KPDV+KSP SDTYIVFGEAKIEDLS Q Q  AAE+FKV      N+    ++  + +  ++EEVDETGVE KDIELVM+QA V R++AV+AL   + DIV+AIMELT
Sbjct:   79 AMSKLGLRQVAGVTRVTIRKSKNILFVITKPDVYKSPASDTYIVFGEAKIEDLSQQAQLAAAEKFKVQGEAVSNIQENTQTPTVQEESEEEEVDETGVEVKDIELVMSQANVSRAKAVRALKNNNNDIVNAIMELT 214          
BLAST of FC930778 vs. ExPASy Swiss-Prot
Match: NACAD_MOUSE (NAC-alpha domain-containing protein 1 OS=Mus musculus GN=Nacad PE=1 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 1.041e-38
Identity = 84/141 (59.57%), Postives = 105/141 (74.47%), Query Frame = 1
Query:  289 AMLKLGMKPIPGVSRVTVKKSKNILFVISKPDVFKSPTSDTYIVFGEAKIEDLSSQLQTQAAEQFKVP-------PPNTGNVASKPESSAMVQDDEEVDETGVEPKDIELVMTQAGVPRSRAVKALXAADGDIVSAIMELT 690
            AM KLG++ I GV+R+T++KSKNILFVI+KPDVFKSP SDTY+VFGEAKIEDLS Q+   AAE+FKVP       P  +     +PE     ++DEEV+E G+EP+DIELVM QA V R++AV+AL     DIV+AIMELT
Sbjct: 1363 AMSKLGLRQIQGVTRITIQKSKNILFVIAKPDVFKSPASDTYVVFGEAKIEDLSQQVHKAAAEKFKVPSEPSALVPELSPGPRVRPECEEQEEEDEEVEEAGLEPRDIELVMAQANVTRAKAVRALKDNHSDIVNAIMELT 1503          
BLAST of FC930778 vs. ExPASy Swiss-Prot
Match: NACA_XENTR (Nascent polypeptide-associated complex subunit alpha OS=Xenopus tropicalis GN=naca PE=2 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 1.359e-38
Identity = 84/136 (61.76%), Postives = 105/136 (77.21%), Query Frame = 1
Query:  289 AMLKLGMKPIPGVSRVTVKKSKNILFVISKPDVFKSPTSDTYIVFGEAKIEDLSSQLQTQAAEQFKVPPPNTGNVASKPESSAMVQ--DDEEVDETGVEPKDIELVMTQAGVPRSRAVKALXAADGDIVSAIMELT 690
            AM KLG++ + GV+RVT++KSKNILFVI+KPDV+KSP SDTYIVFGEAKIEDLS Q Q  AAE+FKV      N+    ++  + +  ++EEVDETGVE KDIELVM+QA V R++AV+AL     DIV+AIMELT
Sbjct:   78 AMSKLGLRQVTGVTRVTIRKSKNILFVITKPDVYKSPASDTYIVFGEAKIEDLSQQAQLAAAEKFKVQGEAVSNIQENTQTPTVQEESEEEEVDETGVEVKDIELVMSQANVSRAKAVRALKNNSNDIVNAIMELT 213          
The following BLAST results are available for this feature:
BLAST of FC930778 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 56
Match NameE-valueIdentityDescription
NACA1_ARATH2.552e-5383.82Nascent polypeptide-associated complex subunit alp... [more]
NACA_PINTA4.353e-5382.22Nascent polypeptide-associated complex subunit alp... [more]
NACA3_ARATH2.641e-5079.43Nascent polypeptide-associated complex subunit alp... [more]
NACA2_ARATH8.791e-4667.86Nascent polypeptide-associated complex subunit alp... [more]
NACA4_ARATH4.824e-4467.86Nascent polypeptide-associated complex subunit alp... [more]
NACA5_ARATH9.097e-4363.31Nascent polypeptide-associated complex subunit alp... [more]
NACA_ORENI5.519e-4063.24Nascent polypeptide-associated complex subunit alp... [more]
NACA_DANRE1.041e-3861.76Nascent polypeptide-associated complex subunit alp... [more]
NACAD_MOUSE1.041e-3859.57NAC-alpha domain-containing protein 1 OS=Mus muscu... [more]
NACA_XENTR1.359e-3861.76Nascent polypeptide-associated complex subunit alp... [more]

Pages

back to top
Libraries
Library NameType
PostHarvP1cdna_library
Properties
Property NameValue
Genbank descriptionC34108H11EF PostHarvP1 Citrus clementina cDNA clone C34108H11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC930778 ID=FC930778|Name=FC930778|organism=Citrus clementina|type=EST|length=736bp
GAATCGGGCATTTAGGGTTTTAGTCTTCTCTCTTTCGTGTCCGCTTCTCG
TTCTCAAGTCTCAACACCCAGCCCAAAAAAAATGACTGCTCAGTCTCAAG
AAGAGCTCCTCGCTGCCCATCTTGAAGAGCAAAAGCTCAACCCCGATGAG
CCTGTAGTCGAGGACGACGATGATGAGGATGATGATGAGGAGGATGAGGA
TGATGACAAGGATGAAGACGATGTGGAAGGGAAAGGAGATGGAAGTGGTC
GCTCAAAACAGAGCAGGAGTGAAAAGAAGAGTCGGAAAGCAATGTTGAAA
CTTGGAATGAAGCCAATCCCTGGCGTCAGTCGAGTTACAGTTAAAAAGAG
CAAAAATATTTTGTTTGTTATCTCCAAACCAGATGTTTTCAAGAGTCCTA
CATCTGACACATACATTGTCTTTGGGGAAGCAAAGATCGAGGATCTGAGT
TCACAACTGCAAACTCAGGCTGCAGAGCAGTTCAAGGTCCCTCCTCCTAA
CACAGGTAATGTGGCATCAAAGCCTGAGTCATCGGCCATGGTTCAAGATG
ACGAAGAAGTAGATGAGACTGGTGTGGAGCCAAAGGACATTGAGTTGGTA
ATGACTCAAGCTGGGGTACCGAGGTCAAGGGCTGTGAAAGCACTCNAAGC
CGCAGATGGTGACATCGTTTCTGCCATTATGGAGCTAACAAATTGATGGT
CACTTTCTTAATTTATGTGCTCTGCTGAATGATCCC
back to top