FC930897

Overview
NameFC930897
Unique NameFC930897
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length665
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15122 contig Ccv1_Contig15122:55..719. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC930897 vs. ExPASy Swiss-Prot
Match: MDAR_SOLLC (Monodehydroascorbate reductase OS=Solanum lycopersicum GN=AFRR PE=1 SV=1)

HSP 1 Score: 348.977 bits (894), Expect = 1.308e-95
Identity = 174/215 (80.93%), Postives = 188/215 (87.44%), Query Frame = 3
Query:   21 MAEKSFKYVILGGGVSAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKAYLFPEGTARLPGFHVCVGSGGERLLPEWYKEKGIELILSTEIVRADIASKTLLSATGLIFKYQILVIATGSTVLRLTDFGVEGADAKNIFYLREIDDADKLVEXXXXXXXXXXXXXXXXYIGLELSAALKINNIDVSMVYPEPWCMPRLFTADIAAFYEGYY 665
            MAEKSFKYVI+GGGVSAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKAYLFPEG ARLPGFHVCVGSGGER LPEWY EKGI LILSTEIV+AD+ASKTL+SA G  FKYQ LVIATG+TVL+L+DFGV+GAD+KNIFYLREIDDAD+LVE                YIGLELSA L++NNI+V+MVYPEPWCMPRLFT  IAAFYEGYY
Sbjct:    1 MAEKSFKYVIVGGGVSAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKAYLFPEGAARLPGFHVCVGSGGERQLPEWYAEKGISLILSTEIVKADLASKTLVSAAGESFKYQTLVIATGTTVLKLSDFGVQGADSKNIFYLREIDDADQLVEALKAKKNGKAVVVGGGYIGLELSAVLRLNNIEVNMVYPEPWCMPRLFTEGIAAFYEGYY 215          
BLAST of FC930897 vs. ExPASy Swiss-Prot
Match: MDAR3_ARATH (Probable monodehydroascorbate reductase, cytoplasmic isoform 3 OS=Arabidopsis thaliana GN=At3g52880 PE=1 SV=1)

HSP 1 Score: 343.584 bits (880), Expect = 5.496e-94
Identity = 169/215 (78.60%), Postives = 189/215 (87.91%), Query Frame = 3
Query:   21 MAEKSFKYVILGGGVSAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKAYLFPEGTARLPGFHVCVGSGGERLLPEWYKEKGIELILSTEIVRADIASKTLLSATGLIFKYQILVIATGSTVLRLTDFGVEGADAKNIFYLREIDDADKLVEXXXXXXXXXXXXXXXXYIGLELSAALKINNIDVSMVYPEPWCMPRLFTADIAAFYEGYY 665
            MAEKSFKY+ILGGGVSAGYAA+EFA QGV+PGELA+ISKEAVAPYERPALSK YLFPEG ARLPGFH CVGSGGE+LLPE YK+KGIELILSTEIV+AD+++K+L+SATG +FKYQ L+IATGSTVLRLTDFGV+GAD+KNI YLREIDDADKLVE                YIGLELSA L+INN+DV+MV+PEPWCMPRLFTADIAAFYE YY
Sbjct:    1 MAEKSFKYIILGGGVSAGYAAKEFANQGVQPGELAVISKEAVAPYERPALSKGYLFPEGAARLPGFHCCVGSGGEKLLPESYKQKGIELILSTEIVKADLSAKSLVSATGDVFKYQTLIIATGSTVLRLTDFGVKGADSKNILYLREIDDADKLVEAIKAKKGGKAVVVGGGYIGLELSAVLRINNLDVTMVFPEPWCMPRLFTADIAAFYETYY 215          
BLAST of FC930897 vs. ExPASy Swiss-Prot
Match: MDARS_CUCSA (Monodehydroascorbate reductase, seedling isozyme OS=Cucumis sativus PE=2 SV=1)

HSP 1 Score: 338.961 bits (868), Expect = 1.354e-92
Identity = 167/215 (77.67%), Postives = 184/215 (85.58%), Query Frame = 3
Query:   21 MAEKSFKYVILGGGVSAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKAYLFPEGTARLPGFHVCVGSGGERLLPEWYKEKGIELILSTEIVRADIASKTLLSATGLIFKYQILVIATGSTVLRLTDFGVEGADAKNIFYLREIDDADKLVEXXXXXXXXXXXXXXXXYIGLELSAALKINNIDVSMVYPEPWCMPRLFTADIAAFYEGYY 665
            MA+++FKYVILGGGV+AGYAAREF KQG+ PGELAIISKEAVAPYERPALSKAYLFPE  ARLPGFHVCVGSGGERLLP+WYKEKGIELILSTEIV AD+ +K L SA G I+ YQ L+IATGSTV++L+DFGV+GADAKNIFYLREIDDAD+LVE                YIGLEL AAL+INN DVSMVYPEPWCMPRLFT +IAAFYEGYY
Sbjct:    1 MADETFKYVILGGGVAAGYAAREFVKQGLNPGELAIISKEAVAPYERPALSKAYLFPESPARLPGFHVCVGSGGERLLPDWYKEKGIELILSTEIVEADLPAKRLRSAHGKIYNYQTLIIATGSTVIKLSDFGVQGADAKNIFYLREIDDADQLVEAIKAKENGKVVVVGGGYIGLELGAALRINNFDVSMVYPEPWCMPRLFTPEIAAFYEGYY 215          
BLAST of FC930897 vs. ExPASy Swiss-Prot
Match: MDAR_PEA (Monodehydroascorbate reductase OS=Pisum sativum PE=1 SV=1)

HSP 1 Score: 325.865 bits (834), Expect = 1.186e-88
Identity = 162/211 (76.78%), Postives = 176/211 (83.41%), Query Frame = 3
Query:   33 SFKYVILGGGVSAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKAYLFPEGTARLPGFHVCVGSGGERLLPEWYKEKGIELILSTEIVRADIASKTLLSATGLIFKYQILVIATGSTVLRLTDFGVEGADAKNIFYLREIDDADKLVEXXXXXXXXXXXXXXXXYIGLELSAALKINNIDVSMVYPEPWCMPRLFTADIAAFYEGYY 665
            SFKY+I+GGGVSAGYAAREF KQGV PGELAIISKEAVAPYERPALSKAYLFPE  ARLPGFH CVGSGGERLLPEWY EKGI+L LSTEIV AD+A+K L SA G  F YQ LVIATGS V+RLTDFGV GA+AKNIFYLRE+DDADKL E                YIGLELSA LK+N++DV+MVYPEPWCMPRLFT++IAAFYEGYY
Sbjct:    4 SFKYIIIGGGVSAGYAAREFVKQGVHPGELAIISKEAVAPYERPALSKAYLFPESPARLPGFHTCVGSGGERLLPEWYSEKGIQLYLSTEIVSADLAAKFLKSANGEHFDYQTLVIATGSAVIRLTDFGVIGANAKNIFYLREVDDADKLYEAIKRKKNAKRVVVGGGYIGLELSAVLKLNDLDVTMVYPEPWCMPRLFTSEIAAFYEGYY 214          
BLAST of FC930897 vs. ExPASy Swiss-Prot
Match: MDAR4_ARATH (Probable monodehydroascorbate reductase, cytoplasmic isoform 4 OS=Arabidopsis thaliana GN=At5g03630 PE=1 SV=1)

HSP 1 Score: 301.597 bits (771), Expect = 2.395e-81
Identity = 149/213 (69.95%), Postives = 169/213 (79.34%), Query Frame = 3
Query:   27 EKSFKYVILGGGVSAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKAYLFPEGTARLPGFHVCVGSGGERLLPEWYKEKGIELILSTEIVRADIASKTLLSATGLIFKYQILVIATGSTVLRLTDFGVEGADAKNIFYLREIDDADKLVEXXXXXXXXXXXXXXXXYIGLELSAALKINNIDVSMVYPEPWCMPRLFTADIAAFYEGYY 665
            EKSFKYVI+GGGV+AGYAAREF  QGVKPGELAIIS+E V PYERPALSK Y+  E  A LP F+V  G GGER  P+WYKEKGIELIL TEIV+AD+A+KTL+S TG +FKYQ L+ ATGS+V+RL+DFGV GADAKNIFYLRE++DAD L                  YIGLEL AALK NN+DV+MVYPEPWCMPRLFTA IA+FYEGYY
Sbjct:    4 EKSFKYVIVGGGVAAGYAAREFFNQGVKPGELAIISREQVPPYERPALSKGYIHLENKATLPNFYVAAGIGGERQFPQWYKEKGIELILGTEIVKADLAAKTLVSGTGQVFKYQTLLAATGSSVIRLSDFGVPGADAKNIFYLRELEDADYLAYAMETKEKGKAVVVGGGYIGLELGAALKANNLDVTMVYPEPWCMPRLFTAGIASFYEGYY 216          
BLAST of FC930897 vs. ExPASy Swiss-Prot
Match: MDAR1_ARATH (Probable monodehydroascorbate reductase, cytoplasmic isoform 1 OS=Arabidopsis thaliana GN=At3g09940 PE=2 SV=1)

HSP 1 Score: 248.825 bits (634), Expect = 1.842e-65
Identity = 123/214 (57.48%), Postives = 160/214 (74.77%), Query Frame = 3
Query:   27 EKSFKYVILGGGVSAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKAYLFPEGTARLPGFHVCVGSGGERLLPEWYKEKGIELILSTEIVRADIASKTLLSATGLIFKYQILVIATGSTVLRLTDFGVEGADAKNIFYLREIDDADKL-VEXXXXXXXXXXXXXXXXYIGLELSAALKINNIDVSMVYPEPWCMPRLFTADIAAFYEGYY 665
            EKS+KYVI+GGGV+ GYAAREF+ QG+KPGELAIISKE V P+ERP L+K Y+  E    L   +VC G+G  +  P WYKEKGI+LI+ TEIV+AD+ASKTL+S  G I+KYQ L+IATGST +RL++ GV+ AD KNIFYLREI+D+D+L +                 ++GLE+S+AL+ NN +V+MV+PEPW + R FTA+IA+FYE YY
Sbjct:    4 EKSYKYVIIGGGVAGGYAAREFSNQGLKPGELAIISKEPVPPFERPELTKVYIDLEVNPTLANIYVCAGTGEAKQYPNWYKEKGIDLIVGTEIVKADLASKTLVSDDGKIYKYQTLLIATGSTNIRLSEIGVQEADVKNIFYLREIEDSDELALAMELYVQRGKAVIIGGGFLGLEISSALRANNHEVTMVFPEPWLVHRFFTAEIASFYESYY 217          
BLAST of FC930897 vs. ExPASy Swiss-Prot
Match: MDAR2_ARATH (Probable monodehydroascorbate reductase, cytoplasmic isoform 2 OS=Arabidopsis thaliana GN=At3g27820 PE=2 SV=1)

HSP 1 Score: 239.58 bits (610), Expect = 1.118e-62
Identity = 116/212 (54.72%), Postives = 150/212 (70.75%), Query Frame = 3
Query:   30 KSFKYVILGGGVSAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKAYLFPEGTARLPGFHVCVGSGGERLLPEWYKEKGIELILSTEIVRADIASKTLLSATGLIFKYQILVIATGSTVLRLTDFGVEGADAKNIFYLREIDDADKLVEXXXXXXXXXXXXXXXXYIGLELSAALKINNIDVSMVYPEPWCMPRLFTADIAAFYEGYY 665
            ++F YVILGGGV+AGYAA EF ++GV  GEL IIS+E VAPYERPALSK +L PE  ARLP FH CVG+  E+L P+WYK+ GIEL+L T +   D+  KTLLS+TG    Y+ L+IATG+  L+L +FGVEG+DA+N+ YLR++ DA++L                  YIG+E +A+L IN I+V+MV+PE  CM RLFT  IA+ YE YY
Sbjct:    3 RAFVYVILGGGVAAGYAALEFTRRGVSDGELCIISEEPVAPYERPALSKGFLLPEAPARLPSFHTCVGANDEKLTPKWYKDHGIELVLGTRVKSVDVRRKTLLSSTGETISYKFLIIATGARALKLEEFGVEGSDAENVCYLRDLADANRLATVIQSSSNGNAVVIGGGYIGMECAASLVINKINVTMVFPEAHCMARLFTPKIASLYEDYY 214          
BLAST of FC930897 vs. ExPASy Swiss-Prot
Match: MDARP_ARATH (Monodehydroascorbate reductase, chloroplastic OS=Arabidopsis thaliana GN=At1g63940 PE=2 SV=3)

HSP 1 Score: 185.267 bits (469), Expect = 2.501e-46
Identity = 101/218 (46.33%), Postives = 132/218 (60.55%), Query Frame = 3
Query:   18 SMAEKSFKYVILGGGVSAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKAYLFP--EGTARLPGFHVCVGSGGERLLPEWYKEKGIELILSTEIVRADIASKTLLSATGLIFKYQILVIATGSTVLRLTDFGVEGADAKNIFYLREIDDADKLVEXXXXXXXXXXXXXXXXYIGLELSAALKINNIDVSMVYPEPWCMPRLFTADIAAFYEGYY 665
            S A ++ ++VI+GGG +AGYAAR F + G+  G L I++KEA APYERPAL+KAYLFP  +  ARLPGFH CVG GGER  P+WYKEKGIE+I    +  AD   +TL +  G   KY  L+IATG T  R  D    G     + Y+RE+ DAD L+                 YIG+E++AA    N+D ++V+PE   + RLFT  +A  YE  Y
Sbjct:   55 SFANENREFVIVGGGNAAGYAARTFVENGMADGRLCIVTKEAYAPYERPALTKAYLFPPEKKPARLPGFHTCVGGGGERQTPDWYKEKGIEVIYEDPVAGADFEKQTLTTDAGKQLKYGSLIIATGCTASRFPD--KIGGHLPGVHYIREVADADSLI--ASLGKAKKIVIVGGGYIGMEVAAAAVAWNLDTTIVFPEDQLLQRLFTPSLAQKYEELY 268          
BLAST of FC930897 vs. ExPASy Swiss-Prot
Match: RURE_PSEOL (Rubredoxin-NAD(+) reductase OS=Pseudomonas oleovorans GN=alkT PE=3 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.480e-14
Identity = 65/201 (32.34%), Postives = 98/201 (48.76%), Query Frame = 3
Query:   45 VILGGGVSAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKAYLFPEGTARLPGFHVCVGSGGERLLPE-WYKEKGIELILSTEIVRADIASKTLLSATGLIFKYQILVIATGSTVLRLTDFGVEGADAKNIFYLREIDDAD----KLVEXXXXXXXXXXXXXXXXYIGLELSAALKINNIDVSMVYPEPWCMPRLFT 632
            V++G G +   AA    + G K GE+ I S+E+VAPY+RP LSKA+L  E           +      L PE +Y    I + L+T IV  D+  K + S  G  + Y+ L++AT ++  RLT    EG++   + YLR ++DA     KLVE                 IGLE+++A       V+++   P  M R+ T
Sbjct:    4 VVVGAGTAGVNAAFWLRQYGYK-GEIRIFSRESVAPYQRPPLSKAFLTSE-----------IAESAVPLKPEGFYTNNNITISLNTPIVSIDVGRKIVSSKDGKEYAYEKLILATPASARRLT---CEGSELSGVCYLRSMEDAKNLRRKLVE------SASVVVLGGGVIGLEVASAAVGLGKRVTVIEATPRVMARVVT 183          
BLAST of FC930897 vs. ExPASy Swiss-Prot
Match: YDGE_SCHPO (Putative flavoprotein C26F1.14C OS=Schizosaccharomyces pombe GN=SPAC26F1.14c PE=2 SV=2)

HSP 1 Score: 68.1662 bits (165), Expect = 4.457e-11
Identity = 54/183 (29.51%), Postives = 82/183 (44.81%), Query Frame = 3
Query:   48 ILGGGVSAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKAYLFPEGTARLPGFHVCVGSGGERLLPEWYKEKGIELILSTEIVRADIASKTLL--SATGLIFKYQILVIATGSTVLRLTDFGVEGADAKNIFYLREIDDADKLVE-XXXXXXXXXXXXXXXXYIGLELSAALKINNIDV 587
            I+GGG  A  AA    ++  K G++ I ++E   PY+RP LSK+ L       L                E+Y +  I    +T++ + D+A K +   S       Y  L++ATG    +L    + G D+KN++ LR I DA KL                   +IGLEL+  LK +N+ V
Sbjct:  162 IIGGGKGASVAAEYLREKNFK-GKITIFTREDEVPYDRPKLSKSLLHDISKLALRS-------------KEYYDDLDISFHFNTDVTKIDLAEKKIYCGSDEKPTESYTKLILATGGEPNKLP---IPGLDSKNVYLLRSIADASKLAAVTTEAGDKKNIVIIGSSFIGLELAVVLKDHNVSV 327          
The following BLAST results are available for this feature:
BLAST of FC930897 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 10
Match NameE-valueIdentityDescription
MDAR_SOLLC1.308e-9580.93Monodehydroascorbate reductase OS=Solanum lycopers... [more]
MDAR3_ARATH5.496e-9478.60Probable monodehydroascorbate reductase, cytoplasm... [more]
MDARS_CUCSA1.354e-9277.67Monodehydroascorbate reductase, seedling isozyme O... [more]
MDAR_PEA1.186e-8876.78Monodehydroascorbate reductase OS=Pisum sativum PE... [more]
MDAR4_ARATH2.395e-8169.95Probable monodehydroascorbate reductase, cytoplasm... [more]
MDAR1_ARATH1.842e-6557.48Probable monodehydroascorbate reductase, cytoplasm... [more]
MDAR2_ARATH1.118e-6254.72Probable monodehydroascorbate reductase, cytoplasm... [more]
MDARP_ARATH2.501e-4646.33Monodehydroascorbate reductase, chloroplastic OS=A... [more]
RURE_PSEOL1.480e-1432.34Rubredoxin-NAD(+) reductase OS=Pseudomonas oleovor... [more]
YDGE_SCHPO4.457e-1129.51Putative flavoprotein C26F1.14C OS=Schizosaccharom... [more]
back to top
Libraries
Library NameType
PostHarvP1cdna_library
Properties
Property NameValue
Genbank descriptionC34110C01EF PostHarvP1 Citrus clementina cDNA clone C34110C01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC930897 ID=FC930897|Name=FC930897|organism=Citrus clementina|type=EST|length=665bp
GAACTTTTTTCGATCGATCAATGGCGGAGAAGAGCTTCAAGTACGTGATC
CTCGGTGGCGGTGTCTCTGCTGGATATGCAGCTAGGGAGTTTGCTAAGCA
GGGTGTTAAGCCAGGCGAGCTGGCAATTATCTCCAAAGAAGCGGTTGCTC
CGTATGAGCGTCCAGCACTTAGCAAGGCATATCTTTTCCCTGAGGGAACT
GCTAGACTTCCCGGTTTCCATGTCTGTGTTGGAAGTGGTGGAGAGAGACT
GCTTCCTGAGTGGTACAAAGAGAAAGGAATCGAATTGATCCTCAGCACGG
AAATAGTCAGAGCAGATATTGCTTCCAAGACTCTCCTTAGTGCAACTGGG
CTTATCTTTAAGTACCAGATTTTAGTAATTGCAACTGGTTCTACAGTTTT
ACGGTTGACTGATTTTGGTGTTGAAGGTGCTGATGCCAAAAATATCTTCT
ACTTAAGAGAAATTGATGATGCTGATAAGCTGGTTGAAGCAATAAAAGCA
AAGAAGAATGGGAAGGCAGTGGTTGTTGGAGGAGGATACATTGGTCTTGA
GCTTAGTGCAGCTTTAAAAATAAATAATATTGATGTTAGCATGGTTTATC
CTGAACCATGGTGCATGCCTCGTCTTTTCACTGCGGATATTGCTGCTTTC
TATGAGGGTTATTAT
back to top