FC930898

Overview
NameFC930898
Unique NameFC930898
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length670
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14276 contig Ccv1_Contig14276:24..693. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC930898 vs. ExPASy Swiss-Prot
Match: PSB6_ARATH (Proteasome subunit beta type-6 OS=Arabidopsis thaliana GN=PBA1 PE=1 SV=2)

HSP 1 Score: 332.413 bits (851), Expect = 1.290e-90
Identity = 163/194 (84.02%), Postives = 177/194 (91.24%), Query Frame = 2
Query:   86 MDLKMEDFNAPHSMGTTIIGVTYNGGFVLGADSRTSTGVYVANRASDKITQLTDNVYLCRSGSAADSQTVSDYVRYFLHQHTIQLGQPATVKVAANLVRLLSYNNKNFLQTGMIVGGWDKYEGGKIYGVPLGGTIIEQPFAIXXXXXXYLYGFFDQAWKEGMTKEEAEALVVKAVSLAIARDGASGGVVRTVTL 667
            MDL ++   APHSMGTTIIGVTYNGG VLGADSRTSTG+YVANRASDKITQLTDNVY+CRSGSAADSQ VSDYVRYFLHQHTIQ GQPATVKV+ANL+R+L+YNNKN LQTG+IVGGWDKYEGGKIYG+PLGGT++EQPFAI      YLYGFFDQAWK+ MTKEEAE LVVKAVSLAIARDGASGGVVRTV +
Sbjct:    1 MDLNLD---APHSMGTTIIGVTYNGGVVLGADSRTSTGMYVANRASDKITQLTDNVYVCRSGSAADSQVVSDYVRYFLHQHTIQHGQPATVKVSANLIRMLAYNNKNMLQTGLIVGGWDKYEGGKIYGIPLGGTVVEQPFAIGGSGSSYLYGFFDQAWKDNMTKEEAEQLVVKAVSLAIARDGASGGVVRTVII 191          
BLAST of FC930898 vs. ExPASy Swiss-Prot
Match: PSB6_TOBAC (Proteasome subunit beta type-6 OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 331.643 bits (849), Expect = 2.201e-90
Identity = 163/188 (86.70%), Postives = 173/188 (92.02%), Query Frame = 2
Query:  104 DFNAPHSMGTTIIGVTYNGGFVLGADSRTSTGVYVANRASDKITQLTDNVYLCRSGSAADSQTVSDYVRYFLHQHTIQLGQPATVKVAANLVRLLSYNNKNFLQTGMIVGGWDKYEGGKIYGVPLGGTIIEQPFAIXXXXXXYLYGFFDQAWKEGMTKEEAEALVVKAVSLAIARDGASGGVVRTVTL 667
            D + PHSMGTTIIGVTYNGG VLGADSRTSTG+YVANRASDKITQLTDNVY+CRSGSAADSQ VSDYVRYFLHQHTIQLGQPATVKVAANL RLLSYNNK+ LQTGMI+GGWDKYEGGKIYG+P GGT++EQPFAI      YLYGFFDQAWKEGMT+EEAE LVV AVSLAIARDGASGGVVRTVT+
Sbjct:    5 DVDQPHSMGTTIIGVTYNGGVVLGADSRTSTGMYVANRASDKITQLTDNVYVCRSGSAADSQIVSDYVRYFLHQHTIQLGQPATVKVAANLTRLLSYNNKDRLQTGMIIGGWDKYEGGKIYGIPPGGTVLEQPFAIGGSGSSYLYGFFDQAWKEGMTQEEAEKLVVTAVSLAIARDGASGGVVRTVTI 192          
BLAST of FC930898 vs. ExPASy Swiss-Prot
Match: PSB6_DICDI (Proteasome subunit beta type-6 OS=Dictyostelium discoideum GN=psmB6 PE=1 SV=1)

HSP 1 Score: 203.371 bits (516), Expect = 9.041e-52
Identity = 92/177 (51.98%), Postives = 131/177 (74.01%), Query Frame = 2
Query:  125 MGTTIIGVTYNGGFVLGADSRTSTGVYVANRASDKITQLTDNVYLCRSGSAADSQTVSDYVRYFLHQHTIQLGQPATVKVAANLVRLLSYNNKNFLQTGMIVGGWDKYEGGKIYGVPLGGTIIEQPFAIXXXXXXYLYGFFDQAWKEGMTKEEAEALVVKAVSLAIARDGASGGVVR 655
            +GT+I+ V Y+GG ++GADSRT+TG Y+ANR ++KIT + + +Y CRSGSAAD+Q +SDYVRY+L  HT +L     VK AA+L +LL Y+NKN L  G+IV GWDK++GG +Y + LGG++++QPFAI      Y+YG+ D  +K  MTK+E    V  +++LA+ RDG+SGGV+R
Sbjct:   13 LGTSIMAVEYDGGVIMGADSRTTTGAYIANRVTNKITPIHERIYCCRSGSAADTQAISDYVRYYLEMHTSELCDEPDVKTAASLFQLLCYSNKNNLMAGIIVAGWDKHQGGSVYNISLGGSMVKQPFAIGGSGSTYIYGYCDSKFKPKMTKDECIEFVQNSLALAMFRDGSSGGVIR 189          
BLAST of FC930898 vs. ExPASy Swiss-Prot
Match: PSB6_BOVIN (Proteasome subunit beta type-6 OS=Bos taurus GN=PSMB6 PE=1 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 3.215e-49
Identity = 91/186 (48.92%), Postives = 127/186 (68.28%), Query Frame = 2
Query:  110 NAPHSMGTTIIGVTYNGGFVLGADSRTSTGVYVANRASDKITQLTDNVYLCRSGSAADSQTVSDYVRYFLHQHTIQLGQPATVKVAANLVRLLSYNNKNFLQTGMIVGGWDKYEGGKIYGVPLGGTIIEQPFAIXXXXXXYLYGFFDQAWKEGMTKEEAEALVVKAVSLAIARDGASGGVVRTVTL 667
            N   S GTTI+ V ++GG VLGADSRT+TG Y+ANR +DK+T + D ++ CRSGSAAD+Q V+D V Y L  H+I+L +P  V  AA+L + + Y  +  L  G+I+ GWD  EGG++Y VP+GG ++ QPFAI      Y+YG+ D  ++EGMTKEE       A++LA+ RDG+SGGV+R   +
Sbjct:   28 NREVSTGTTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDRIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFKEMCYRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMMVRQPFAIGGSGSSYIYGYVDATYREGMTKEECLQFTANALALAMERDGSSGGVIRLAAI 213          
BLAST of FC930898 vs. ExPASy Swiss-Prot
Match: PSB6_SCHPO (Probable proteasome subunit beta type-6 OS=Schizosaccharomyces pombe GN=SPBC4C3.10c PE=2 SV=1)

HSP 1 Score: 192.971 bits (489), Expect = 1.222e-48
Identity = 91/181 (50.28%), Postives = 125/181 (69.06%), Query Frame = 2
Query:  125 MGTTIIGVTYNGGFVLGADSRTSTGVYVANRASDKITQLTDNVYLCRSGSAADSQTVSDYVRYFLHQHTIQLGQPATVKVAANLVRLLSYNNKNFLQTGMIVGGWDKYEGGKIYGVPLGGTIIEQPFAIXXXXXXYLYGFFDQAWKEGMTKEEAEALVVKAVSLAIARDGASGGVVRTVTL 667
            MGTTI  + Y  G +L ADSRT+ G Y+ANR +DK+TQLTDN++ CRSGSAAD+QTV+D ++Y+L  + IQ G   +V  AA L   + Y NKN L  G+IV G+D+  GG +Y +PLGG++ +QP AI      ++YGF D  ++E MT+EEA   +  AV+LA+ RDG+SGG +R V L
Sbjct:   23 MGTTITALRYKDGVILAADSRTTMGAYIANRVTDKLTQLTDNIWCCRSGSAADTQTVADLLKYYLSMYRIQFGHDPSVHTAATLASEMCYQNKNMLSAGLIVAGYDEKTGGDVYSIPLGGSLHKQPLAIGGSGSAFIYGFCDANFRENMTQEEAVEFLKNAVALAMERDGSSGGTIRMVIL 203          
BLAST of FC930898 vs. ExPASy Swiss-Prot
Match: PSB6_MOUSE (Proteasome subunit beta type-6 OS=Mus musculus GN=Psmb6 PE=1 SV=3)

HSP 1 Score: 192.971 bits (489), Expect = 1.222e-48
Identity = 90/186 (48.39%), Postives = 127/186 (68.28%), Query Frame = 2
Query:  110 NAPHSMGTTIIGVTYNGGFVLGADSRTSTGVYVANRASDKITQLTDNVYLCRSGSAADSQTVSDYVRYFLHQHTIQLGQPATVKVAANLVRLLSYNNKNFLQTGMIVGGWDKYEGGKIYGVPLGGTIIEQPFAIXXXXXXYLYGFFDQAWKEGMTKEEAEALVVKAVSLAIARDGASGGVVRTVTL 667
            N   S GTTI+ V +NGG VLGADSRT+TG Y+ANR +DK+T + D+++ CRSGSAAD+Q V+D V Y L  H+I+L +P  V  AA+L + + Y  +  L  G+I+ GWD  EGG++Y VP+GG ++ Q FAI      Y+YG+ D  ++EGMTK+E       A++LA+ RDG+SGGV+R   +
Sbjct:   27 NREVSTGTTIMAVQFNGGVVLGADSRTTTGSYIANRVTDKLTPIHDHIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFKEMCYRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMMVRQSFAIGGSGSSYIYGYVDATYREGMTKDECLQFTANALALAMERDGSSGGVIRLAAI 212          
BLAST of FC930898 vs. ExPASy Swiss-Prot
Match: PSB6_HUMAN (Proteasome subunit beta type-6 OS=Homo sapiens GN=PSMB6 PE=1 SV=4)

HSP 1 Score: 191.43 bits (485), Expect = 3.555e-48
Identity = 89/182 (48.90%), Postives = 125/182 (68.68%), Query Frame = 2
Query:  122 SMGTTIIGVTYNGGFVLGADSRTSTGVYVANRASDKITQLTDNVYLCRSGSAADSQTVSDYVRYFLHQHTIQLGQPATVKVAANLVRLLSYNNKNFLQTGMIVGGWDKYEGGKIYGVPLGGTIIEQPFAIXXXXXXYLYGFFDQAWKEGMTKEEAEALVVKAVSLAIARDGASGGVVRTVTL 667
            S GTTI+ V ++GG VLGADSRT+TG Y+ANR +DK+T + D ++ CRSGSAAD+Q V+D V Y L  H+I+L +P  V  AA+L + + Y  +  L  G+I+ GWD  EGG++Y VP+GG ++ Q FAI      Y+YG+ D  ++EGMTKEE       A++LA+ RDG+SGGV+R   +
Sbjct:   32 STGTTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDRIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFKEMCYRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMMVRQSFAIGGSGSSYIYGYVDATYREGMTKEECLQFTANALALAMERDGSSGGVIRLAAI 213          
BLAST of FC930898 vs. ExPASy Swiss-Prot
Match: PSB6_RAT (Proteasome subunit beta type-6 OS=Rattus norvegicus GN=Psmb6 PE=1 SV=3)

HSP 1 Score: 191.045 bits (484), Expect = 4.643e-48
Identity = 89/186 (47.85%), Postives = 127/186 (68.28%), Query Frame = 2
Query:  110 NAPHSMGTTIIGVTYNGGFVLGADSRTSTGVYVANRASDKITQLTDNVYLCRSGSAADSQTVSDYVRYFLHQHTIQLGQPATVKVAANLVRLLSYNNKNFLQTGMIVGGWDKYEGGKIYGVPLGGTIIEQPFAIXXXXXXYLYGFFDQAWKEGMTKEEAEALVVKAVSLAIARDGASGGVVRTVTL 667
            N   S GTTI+ V ++GG VLGADSRT+TG Y+ANR +DK+T + D+++ CRSGSAAD+Q V+D V Y L  H+I+L +P  V  AA+L + + Y  +  L  G+I+ GWD  EGG++Y VP+GG ++ Q FAI      Y+YG+ D  ++EGMTK+E       A++LA+ RDG+SGGV+R   +
Sbjct:   27 NREVSTGTTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDHIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFKEMCYRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMMVRQSFAIGGSGSSYIYGYVDATYREGMTKDECLQFTANALALAMERDGSSGGVIRLAAI 212          
BLAST of FC930898 vs. ExPASy Swiss-Prot
Match: PSB6_YEAST (Proteasome component PRE3 OS=Saccharomyces cerevisiae GN=PRE3 PE=1 SV=2)

HSP 1 Score: 174.096 bits (440), Expect = 5.874e-43
Identity = 83/182 (45.60%), Postives = 128/182 (70.33%), Query Frame = 2
Query:  122 SMGTTIIGVTYNGGFVLGADSRTSTGVYVANRASDKITQLTDNVYLCRSGSAADSQTVSDYVRYFLHQHTIQLGQPATVKVAANLVRLLSYNNKNFLQTGMIVGGWDKYEGGKIYGVPLGGTIIEQPFAIXXXXXXYLYGFFDQAWKEGMTKEEAEALVVKAVSLAIARDGASGGVVRTVTL 667
            S+GT+I+ VT+  G +LGADSRT+TG Y+ANR +DK+T++ D ++ CRSGSAAD+Q ++D V+Y L  +T Q G P+T + AA++ + L Y NK+ L  G+IV G+D    G++Y +PLGG++ + P+AI      ++YG+ D+ ++E M+KEE    +  ++S AI  DG+SGGV+R V L
Sbjct:   17 SLGTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIVQYHLELYTSQYGTPST-ETAASVFKELCYENKDNLTAGIIVAGYDDKNKGEVYTIPLGGSVHKLPYAIAGSGSTFIYGYCDKNFRENMSKEETVDFIKHSLSQAIKWDGSSGGVIRMVVL 197          
BLAST of FC930898 vs. ExPASy Swiss-Prot
Match: PSB9_RAT (Proteasome subunit beta type-9 OS=Rattus norvegicus GN=Psmb9 PE=1 SV=2)

HSP 1 Score: 169.088 bits (427), Expect = 1.889e-41
Identity = 82/180 (45.56%), Postives = 117/180 (65.00%), Query Frame = 2
Query:  128 GTTIIGVTYNGGFVLGADSRTSTGVYVANRASDKITQLTDNVYLCRSGSAADSQTVSDYVRYFLHQHTIQLGQPATVKVAANLVRLLSYNNKNFLQTGMIVGGWDKYEGGKIYGVPLGGTIIEQPFAIXXXXXXYLYGFFDQAWKEGMTKEEAEALVVKAVSLAIARDGASGGVVRTVTL 667
            GTTI+ V ++GG V+G+DSR S G  V NR  DK++ L   +Y   SGSAAD+Q ++D   Y L  H ++L +P  V  AAN+V+ +SY  +  L   ++V GWD++EGG++YG  +GG +I QPFAI      Y+YG+ D A+K GMT EE       A++LA+ RDG+SGGV+  VT+
Sbjct:   20 GTTIMAVEFDGGVVVGSDSRVSAGAAVVNRVFDKLSPLHQRIYCALSGSAADAQAIADMAAYQLELHGLELEEPPLVLAAANIVKNISYKYREDLLAHLMVAGWDQHEGGQVYGT-MGGMLIRQPFAIGGSGSTYIYGYVDAAYKPGMTPEECRRFTTDAITLAMNRDGSSGGVIYLVTI 198          
The following BLAST results are available for this feature:
BLAST of FC930898 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 64
Match NameE-valueIdentityDescription
PSB6_ARATH1.290e-9084.02Proteasome subunit beta type-6 OS=Arabidopsis thal... [more]
PSB6_TOBAC2.201e-9086.70Proteasome subunit beta type-6 OS=Nicotiana tabacu... [more]
PSB6_DICDI9.041e-5251.98Proteasome subunit beta type-6 OS=Dictyostelium di... [more]
PSB6_BOVIN3.215e-4948.92Proteasome subunit beta type-6 OS=Bos taurus GN=PS... [more]
PSB6_SCHPO1.222e-4850.28Probable proteasome subunit beta type-6 OS=Schizos... [more]
PSB6_MOUSE1.222e-4848.39Proteasome subunit beta type-6 OS=Mus musculus GN=... [more]
PSB6_HUMAN3.555e-4848.90Proteasome subunit beta type-6 OS=Homo sapiens GN=... [more]
PSB6_RAT4.643e-4847.85Proteasome subunit beta type-6 OS=Rattus norvegicu... [more]
PSB6_YEAST5.874e-4345.60Proteasome component PRE3 OS=Saccharomyces cerevis... [more]
PSB9_RAT1.889e-4145.56Proteasome subunit beta type-9 OS=Rattus norvegicu... [more]

Pages

back to top
Libraries
Library NameType
PostHarvP1cdna_library
Properties
Property NameValue
Genbank descriptionC34110C02EF PostHarvP1 Citrus clementina cDNA clone C34110C02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC930898 ID=FC930898|Name=FC930898|organism=Citrus clementina|type=EST|length=670bp
AAAGAAGCAAAATTAAAATTAAACTCAAAATTAAAATTGTTAAGGGCATT
TAGAAATTGTGGTAAGTGAGTGTTTTAGAGGAAAGATGGATCTGAAGATG
GAAGATTTTAACGCGCCACACTCGATGGGTACTACTATCATCGGCGTCAC
TTACAACGGCGGCTTTGTCCTCGGCGCCGATTCTCGTACTAGCACCGGGG
TGTATGTTGCTAACCGAGCTTCAGACAAGATTACGCAGCTCACTGATAAT
GTCTACCTTTGCCGCTCGGGATCGGCTGCAGATTCTCAGACTGTCTCCGA
CTATGTTCGCTACTTCCTTCATCAACACACGATACAGCTAGGGCAGCCTG
CAACTGTTAAAGTTGCTGCCAATCTTGTCAGGCTGCTATCCTACAATAAC
AAGAACTTTTTGCAAACTGGAATGATTGTTGGCGGTTGGGATAAGTATGA
AGGTGGTAAAATATATGGAGTTCCTCTTGGAGGAACAATAATTGAGCAGC
CTTTTGCAATTGGAGGATCTGGCTCAAGTTACCTGTATGGGTTTTTTGAT
CAGGCATGGAAAGAGGGAATGACCAAGGAAGAAGCTGAAGCATTAGTGGT
TAAAGCAGTTTCTCTTGCCATTGCGCGTGATGGTGCTAGTGGAGGTGTTG
TTCGAACCGTCACATTAATT
back to top