FC931064

Overview
NameFC931064
Unique NameFC931064
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length708
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15262 contig Ccv1_Contig15262:1..708. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931064 vs. ExPASy Swiss-Prot
Match: Y4103_VIBPA (UPF0189 protein VPA0103 OS=Vibrio parahaemolyticus GN=VPA0103 PE=3 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 1.608e-33
Identity = 72/120 (60.00%), Postives = 88/120 (73.33%), Query Frame = 3
Query:  321 VNSANEKMLGGGGCDGAIHRAAGPELLEACYRVPEVGFGIRCPTGEARITPGFKLPASHVIHTVGPIYGVTINPEASLRSAYKNSLSLAKANNIQYIAFPAISCGLYCYPHEEAATIAIS 680
            VN+AN +MLGGGG DGAIHRAAGP L+ ACY V +V  GIRCP G+ARIT    L A +VIH VGPIY    +P+  L SAY+ SL LA AN+ Q +A PAISCG+Y YP +EAA +A++
Sbjct:   20 VNAANPRMLGGGGVDGAIHRAAGPALINACYAVDDVD-GIRCPFGDARITEAGNLNARYVIHAVGPIYDKFADPKTVLESAYQRSLDLALANHCQSVALPAISCGVYGYPPQEAAEVAMA 138          
BLAST of FC931064 vs. ExPASy Swiss-Prot
Match: Y3184_XANCP (UPF0189 protein XCC3184 OS=Xanthomonas campestris pv. campestris GN=XCC3184 PE=3 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 2.100e-33
Identity = 73/127 (57.48%), Postives = 90/127 (70.87%), Query Frame = 3
Query:  321 VNSANEKMLGGGGCDGAIHRAAGPELLEACYRVPEVGFGIRCPTGEARITPGFKLPASHVIHTVGPIY--GVTINPEASLRSAYKNSLSLAKANNIQYIAFPAISCGLYCYPHEEAATIAISTVKEF 695
            VN+ANE +LGGGG DGAIHRAAGP LLEAC  +PEV  G+RCPTGE RIT GF L A H+ HTVGP++  G    PE  L + Y  SL LA+   +  IAFPAISCG+Y YP  +AA IA++  +++
Sbjct:   19 VNAANESLLGGGGVDGAIHRAAGPRLLEACEALPEVRPGVRCPTGEIRITDGFDLKARHIFHTVGPVWRDGKHNEPE-QLANCYWQSLKLAEQMMLHSIAFPAISCGIYGYPLYQAARIAVTETRDW 144          
BLAST of FC931064 vs. ExPASy Swiss-Prot
Match: Y3343_XANAC (UPF0189 protein XAC3343 OS=Xanthomonas axonopodis pv. citri GN=XAC3343 PE=3 SV=2)

HSP 1 Score: 141.739 bits (356), Expect = 3.583e-33
Identity = 72/127 (56.69%), Postives = 90/127 (70.87%), Query Frame = 3
Query:  321 VNSANEKMLGGGGCDGAIHRAAGPELLEACYRVPEVGFGIRCPTGEARITPGFKLPASHVIHTVGPIY--GVTINPEASLRSAYKNSLSLAKANNIQYIAFPAISCGLYCYPHEEAATIAISTVKEF 695
            VN+ANE +LGGGG DGAIHRAAGP LLEAC  +P+V  G+RCPTGE RIT GF L A H+ HTVGP++  G    PE  L + Y  SL LA+   +  IAFPAISCG+Y YP  +AA IA++  +++
Sbjct:   19 VNAANESLLGGGGVDGAIHRAAGPRLLEACEALPQVRPGVRCPTGEIRITDGFDLKARHIFHTVGPVWRDGRHNEPE-QLANCYWQSLKLAEQMMLHSIAFPAISCGIYGYPLHQAARIAVTETRDW 144          
BLAST of FC931064 vs. ExPASy Swiss-Prot
Match: Y334_RALSO (UPF0189 protein RSc0334 OS=Ralstonia solanacearum GN=RSc0334 PE=3 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 4.380e-31
Identity = 72/129 (55.81%), Postives = 93/129 (72.09%), Query Frame = 3
Query:  321 VNSANEKMLGGGGCDGAIHRAAGPELLEACYRVPEVGFGIRCPTGEARITPGFKLPASHVIHTVGPIYGVTINPEASLRSA-YKNSLSLAKANNIQYIAFPAISCGLYCYPHEEAATIAISTVKEFAND 704
            VN+AN  +LGGGG DGAIHRAAGPELLEAC  +        C TG+A+ITPGF LPA ++IHTVGPI+      EA+L +A Y+NSL+LAK ++++ IAFP IS G+Y +P + AA IA+ TV+E   D
Sbjct:   24 VNAANSALLGGGGVDGAIHRAAGPELLEACRALH------GCRTGQAKITPGFLLPARYIIHTVGPIWRGGRQDEAALLAACYRNSLALAKQHDVRTIAFPCISTGVYGFPPQLAAPIAVRTVREHGAD 146          
BLAST of FC931064 vs. ExPASy Swiss-Prot
Match: Y2219_CHLTE (UPF0189 protein CT2219 OS=Chlorobium tepidum GN=CT2219 PE=3 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 1.274e-30
Identity = 74/129 (57.36%), Postives = 94/129 (72.87%), Query Frame = 3
Query:  321 VNSANEKMLGGGGCDGAIHRAAGPELLEACYRVPEVGFGIRCPTGEARITPGFKLPASHVIHTVGPIYGVTINPEASL-RSAYKNSLSLAKANNIQYIAFPAISCGLYCYPHEEAATIAISTVKEFAND 704
            VN+AN  +LGGGG DGAIHRAAGP+LLEAC    E+G    C TGEA+IT G++LPA+ VIHTVGP++    + EA L  S Y+NSL LA  ++ + IAFP+IS G+Y YP E+AA IAI+TV+E   D
Sbjct:   23 VNAANTSLLGGGGVDGAIHRAAGPKLLEACR---ELG---GCLTGEAKITKGYRLPATFVIHTVGPVWHGGNHGEAELLASCYRNSLKLAIEHHCRTIAFPSISTGIYGYPVEQAAAIAITTVREMLAD 145          
BLAST of FC931064 vs. ExPASy Swiss-Prot
Match: MACD2_XENLA (MACRO domain-containing protein 2 OS=Xenopus laevis GN=macrod2 PE=2 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 8.260e-30
Identity = 70/127 (55.12%), Postives = 90/127 (70.87%), Query Frame = 3
Query:  321 VNSANEKMLGGGGCDGAIHRAAGPELLEACYRVPEVGFGIRCPTGEARITPGFKLPASHVIHTVGPIYG--VTINPEASLRSAYKNSLSLAKANNIQYIAFPAISCGLYCYPHEEAATIAISTVKEF 695
            VN+AN  +LGGGG DG IHRA+GP LL  C    E+G    C TG+A+IT G++LPA +VIHTVGPI    +T N +  L S Y +SL+LA  N+I+ IAFP IS G+Y YP+E AA +A++TVKEF
Sbjct:   86 VNAANTSLLGGGGVDGCIHRASGPSLLAECR---ELG---GCETGQAKITCGYELPAKYVIHTVGPIARGHITPNHKQDLASCYNSSLTLATENDIRTIAFPCISTGIYGYPNEPAANVALTTVKEF 206          
BLAST of FC931064 vs. ExPASy Swiss-Prot
Match: Y177_METMA (UPF0189 protein MM_0177 OS=Methanosarcina mazei GN=MM_0177 PE=3 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 1.409e-29
Identity = 70/126 (55.56%), Postives = 85/126 (67.46%), Query Frame = 3
Query:  321 VNSANEKMLGGGGCDGAIHRAAGPELLEACYRVPEVGFGIRCPTGEARITPGFKLPASHVIHTVGPIY-GVTINPEASLRSAYKNSLSLAKANNIQYIAFPAISCGLYCYPHEEAATIAISTVKEF 695
            VN+AN  +LGGGG DGAIHRAAGP LLE C  +        CPTGEA+IT G+ LPA ++IHTVGP++ G     +  L S Y+ SL LA+   I+ IAFPAIS G Y +P E AA IA+S VKEF
Sbjct:   37 VNAANNTLLGGGGVDGAIHRAAGPALLEECKTLNG------CPTGEAKITSGYLLPAKYIIHTVGPVWQGGEKGEDELLASCYRKSLELARDYKIKTIAFPAISTGAYGFPSERAAGIAVSQVKEF 156          
BLAST of FC931064 vs. ExPASy Swiss-Prot
Match: Y3693_PSEAE (UPF0189 protein PA3693 OS=Pseudomonas aeruginosa GN=PA3693 PE=3 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 2.403e-29
Identity = 69/123 (56.10%), Postives = 85/123 (69.11%), Query Frame = 3
Query:  321 VNSANEKMLGGGGCDGAIHRAAGPELLEACYRVPEVGFGIRCPTGEARITPGFKLPASHVIHTVGPIYGVTINPEAS-LRSAYKNSLSLAKANNIQYIAFPAISCGLYCYPHEEAATIAISTV 686
            VN+AN  +LGGGG DGAIHRAAG EL+ AC  +        C TGEA+IT GF+LPA+HVIHTVGP++    N EA  L S Y+ SL+LA+      +AFPAISCG+Y YP E+AA IA+  V
Sbjct:   20 VNAANSSLLGGGGVDGAIHRAAGAELVAACRLLHG------CKTGEAKITRGFRLPAAHVIHTVGPVWRGGDNGEAELLASCYRRSLALAEQAGAASVAFPAISCGIYGYPLEQAAAIAVEEV 136          
BLAST of FC931064 vs. ExPASy Swiss-Prot
Match: Y1614_METAC (UPF0189 protein MA_1614 OS=Methanosarcina acetivorans GN=MA_1614 PE=3 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 2.403e-29
Identity = 70/126 (55.56%), Postives = 85/126 (67.46%), Query Frame = 3
Query:  321 VNSANEKMLGGGGCDGAIHRAAGPELLEACYRVPEVGFGIRCPTGEARITPGFKLPASHVIHTVGPIYGV-TINPEASLRSAYKNSLSLAKANNIQYIAFPAISCGLYCYPHEEAATIAISTVKEF 695
            VN+AN  +LGGGG DGAIHRAAGP LLE C  +        CPTGEA+IT G+ LPA +VIHTVGPI+   T   +  L S Y+ SL LA+  +++ IAFP IS G Y +P E AA IA+S VKEF
Sbjct:   45 VNAANNTLLGGGGVDGAIHRAAGPGLLEECRTLNG------CPTGEAKITKGYLLPAKYVIHTVGPIWQEGTKGEDEFLASCYRKSLELARKYDVKTIAFPTISTGAYGFPSERAARIAVSQVKEF 164          
BLAST of FC931064 vs. ExPASy Swiss-Prot
Match: Y4133_LEPIN (UPF0189 protein LA_4133 OS=Leptospira interrogans GN=LA_4133 PE=3 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 9.132e-29
Identity = 69/126 (54.76%), Postives = 86/126 (68.25%), Query Frame = 3
Query:  321 VNSANEKMLGGGGCDGAIHRAAGPELLEACYRVPEVGFGIRCPTGEARITPGFKLPASHVIHTVGPIY-GVTINPEASLRSAYKNSLSLAKANNIQYIAFPAISCGLYCYPHEEAATIAISTVKEF 695
            VN+AN  +LGGGG DGAIHRA GPE+LE CY++ E      C  GEA IT   +L A  +IHTVGPI+ G   N +  L +AYKNSL LAK ++++ IAFP IS G+Y +P E AA IAI +V EF
Sbjct:   21 VNAANSSLLGGGGVDGAIHRAGGPEILEECYKIREKQG--ECKVGEAVITTAGRLNAKFIIHTVGPIWSGGNKNEDELLSNAYKNSLLLAKNHSLKTIAFPNISTGIYHFPKERAAKIAIQSVTEF 144          
The following BLAST results are available for this feature:
BLAST of FC931064 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 66
Match NameE-valueIdentityDescription
Y4103_VIBPA1.608e-3360.00UPF0189 protein VPA0103 OS=Vibrio parahaemolyticus... [more]
Y3184_XANCP2.100e-3357.48UPF0189 protein XCC3184 OS=Xanthomonas campestris ... [more]
Y3343_XANAC3.583e-3356.69UPF0189 protein XAC3343 OS=Xanthomonas axonopodis ... [more]
Y334_RALSO4.380e-3155.81UPF0189 protein RSc0334 OS=Ralstonia solanacearum ... [more]
Y2219_CHLTE1.274e-3057.36UPF0189 protein CT2219 OS=Chlorobium tepidum GN=CT... [more]
MACD2_XENLA8.260e-3055.12MACRO domain-containing protein 2 OS=Xenopus laevi... [more]
Y177_METMA1.409e-2955.56UPF0189 protein MM_0177 OS=Methanosarcina mazei GN... [more]
Y3693_PSEAE2.403e-2956.10UPF0189 protein PA3693 OS=Pseudomonas aeruginosa G... [more]
Y1614_METAC2.403e-2955.56UPF0189 protein MA_1614 OS=Methanosarcina acetivor... [more]
Y4133_LEPIN9.132e-2954.76UPF0189 protein LA_4133 OS=Leptospira interrogans ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101A07EF PostHarvP1 Citrus clementina cDNA clone C34101A07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931064 ID=FC931064|Name=FC931064|organism=Citrus clementina|type=EST|length=708bp
GGAGCTTGATTGATCAGGGATTATGAATGCTTCCTCTACCAAAGGATCTT
TTTGAGAGTGCTTTTGGTAGTGCCTAAAGCGCTTTTAAGTAGCCAAGAGC
CATTGTGTCTATTGGTGTTTTCCTAGAGATCTTTTGACATTAGAAAGTGC
TTTTTGAACAAATAATTTATTGGTGTTTTTGCAAGAAGAACAATTGACTT
GAAAGTACTTTTTTGCAAAATCACTGGCAGCACACCTTACAGTTAATGAT
CGCTTGATTGAATAGGAAGGTTGGTGTTGAAAAGGGAAATTGCAATTGAT
TGAATGGTTGTTTGCTATAGGTTAATTCAGCCAATGAGAAAATGCTTGGA
GGTGGCGGTTGCGATGGAGCTATACATAGGGCTGCAGGACCAGAACTTCT
AGAAGCTTGTTATAGAGTTCCAGAAGTTGGATTTGGAATCCGTTGTCCCA
CAGGAGAAGCAAGAATTACACCAGGTTTTAAATTGCCTGCATCTCATGTG
ATTCACACTGTTGGCCCAATCTATGGTGTTACTATTAACCCTGAAGCTTC
CCTGAGAAGTGCGTACAAGAACAGCTTGAGCTTGGCCAAAGCGAATAACA
TTCAGTACATTGCTTTTCCTGCCATATCGTGTGGCTTATATTGTTATCCT
CATGAGGAAGCCGCCACAATAGCTATATCTACAGTCAAAGAATTTGCTAA
TGACTTTA
back to top