FC931067

Overview
NameFC931067
Unique NameFC931067
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length723
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC931067 vs. ExPASy Swiss-Prot
Match: IP5P2_ARATH (Type I inositol-1,4,5-trisphosphate 5-phosphatase 2 OS=Arabidopsis thaliana GN=IP5P2 PE=1 SV=2)

HSP 1 Score: 242.662 bits (618), Expect = 1.546e-63
Identity = 113/159 (71.07%), Postives = 133/159 (83.65%), Query Frame = 1
Query:    4 TDQPQTSPSHDQIFWFGDLNYRLNMMDTEVRELVAQKRWDKLINSDQLSKELHSGHVFEGWKEGVINFPPTYKYEINSDRYVGENPKEGEKKRSPAWCDRILWLGKGIKQLAYTRAEILLSDHRPVSSTFLVQVEVLDHRKLKRALNVSSA---VVHPD 471
            TDQP+T P HDQ+FWFGDLNYRLNM D EVR+LV+QKRWD+L NSDQL +EL  GHVF+GW+EG I FPPTYKYE +SDRY GEN +E EKKR+PAWCDRILWLGKGI+Q  Y R+EI +SDHRPV+S F V VEV DHRKL+RAL+V++A    VHP+
Sbjct:  485 TDQPRTIPCHDQVFWFGDLNYRLNMSDGEVRKLVSQKRWDELKNSDQLIRELRRGHVFDGWREGPIKFPPTYKYEFDSDRYAGENLREPEKKRAPAWCDRILWLGKGIRQECYKRSEIRMSDHRPVTSIFNVGVEVFDHRKLQRALHVNNAAASAVHPE 643          
BLAST of FC931067 vs. ExPASy Swiss-Prot
Match: IP5P1_ARATH (Type I inositol-1,4,5-trisphosphate 5-phosphatase 1 OS=Arabidopsis thaliana GN=IP5P1 PE=1 SV=2)

HSP 1 Score: 181.415 bits (459), Expect = 4.230e-45
Identity = 80/150 (53.33%), Postives = 113/150 (75.33%), Query Frame = 1
Query:   13 PQTSPSHDQIFWFGDLNYRLNMMDTEVRELVAQKRWDKLINSDQLSKELHSGHVFEGWKEGVINFPPTYKYEINSDRYVGENPKEGEKKRSPAWCDRILWLGKGIKQLAYTRAEILLSDHRPVSSTFLVQVEVLDHRKLKRALNVSSAVV 462
            P++  +H++I W GDLNYR+N+   +  EL+A+K W +L+  DQLS+E+  G++FEGW EG ++F PTYKYEI+S+ Y+G++P+ G  KR PAWCDRI+W GKG+K   Y R EI LSDHRPV++TFL +VEVL  RKL+ AL ++ A +
Sbjct:  438 PRSICNHERIIWLGDLNYRINLSYEKTHELIARKEWQRLVEYDQLSREMTKGNLFEGWSEGTLDFAPTYKYEIDSENYIGDDPESG--KRRPAWCDRIIWNGKGMKLFNYRRNEIKLSDHRPVTATFLAEVEVLSPRKLQHALTLTYAEI 585          
BLAST of FC931067 vs. ExPASy Swiss-Prot
Match: IP5P3_ARATH (Type I inositol-1,4,5-trisphosphate 5-phosphatase CVP2 OS=Arabidopsis thaliana GN=CVP2 PE=1 SV=2)

HSP 1 Score: 158.303 bits (399), Expect = 3.835e-38
Identity = 73/153 (47.71%), Postives = 97/153 (63.40%), Query Frame = 1
Query:   13 PQTSPSHDQIFWFGDLNYRLNMMDTEVRELVAQKRWDKLINSDQLSKELHSGHVFEGWKEGVINFPPTYKYEINSDRYVGENPKEGEKKRSPAWCDRILWLGKGIKQLAYTRAEILLSDHRPVSSTFLVQVEVLDHRKLKRALNVSSAVVHPD 471
            P+    HD++ W GDLNYR+ +     + LV  + W  L+ +DQL  E   GHVF+GW EG I FPPTYKY  NSDRY G++    EK+R+PAWCDRILW G+G+ QL+Y R E   SDHRPV   F  +VE   H ++KR  + S++ V  +
Sbjct:  451 PENILQHDRVIWLGDLNYRIALSYRSAKALVEMQNWRALLENDQLRIEQKRGHVFKGWNEGKIYFPPTYKYSRNSDRYSGDDLHPKEKRRTPAWCDRILWFGEGLHQLSYVRGESRFSDHRPVYGIFCAEVESA-HNRIKRTTSYSASRVQAE 602          
BLAST of FC931067 vs. ExPASy Swiss-Prot
Match: INP52_YEAST (Inositol-1,4,5-trisphosphate 5-phosphatase 2 OS=Saccharomyces cerevisiae GN=INP52 PE=1 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 1.785e-27
Identity = 60/140 (42.86%), Postives = 92/140 (65.71%), Query Frame = 1
Query:   16 QTSPSHDQIFWFGDLNYRLNMMDTEVR-ELVAQKRW--DKLINSDQLSKELHSGHVFEGWKEGVINFPPTYKYEINSDRYVGENPKEGEKKRSPAWCDRILWLGKGIKQLAYTRAEILLSDHRPVSSTFLVQVEVLDHRK 426
            +T P HD +FW GDLNYR+ + + EVR EL AQK    D+L+  DQL++E++ G VF+G+KE  + F PTYKY+  +D Y        EK R+P+W DRI++ G+ +  LAY+ A + +SDH+PV + +   V+ +D ++
Sbjct:  758 KTIPHHDSLFWLGDLNYRITLTNDEVRRELRAQKDGYIDRLLQYDQLTQEINEGVVFQGFKEPTLQFRPTYKYDYGTDNY-----DTSEKARTPSWTDRIIYKGENLHPLAYSDAPLKISDHKPVYAAYRANVKFVDEKE 892          
BLAST of FC931067 vs. ExPASy Swiss-Prot
Match: INP53_YEAST (Inositol-1,4,5-trisphosphate 5-phosphatase 3 OS=Saccharomyces cerevisiae GN=INP53 PE=1 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 2.332e-27
Identity = 63/155 (40.65%), Postives = 99/155 (63.87%), Query Frame = 1
Query:   25 PSHDQIFWFGDLNYRLNMMDTEVR-ELVAQKRW--DKLINSDQLSKELHSGHVFEGWKEGVINFPPTYKYEINSDRYVGENPKEGEKKRSPAWCDRILWLGKGIKQLAYTRAEILLSDHRPVSSTFLVQVEVLDHRK---LKRALNVSSAVVHPD 471
            P HD IFW GD+NYR+N+ + +VR EL+ Q+    DKL++ DQL+  ++SG VFEG+KE  + F PTYKY+  +  Y        EK+R+P+W DRI++ G+ +  L+Y+ A I++SDHRPV + +  ++  +D ++   LK+ L       HP+
Sbjct:  736 PHHDSIFWLGDMNYRINLPNEDVRRELLNQEEGYIDKLLHFDQLTLGINSGSVFEGFKEPTLKFRPTYKYDPGTGTY-----DSSEKERTPSWTDRIIYKGENLLPLSYSDAPIMISDHRPVYAAYRAKITFVDDKERLSLKKRLFTEYKQEHPE 885          
BLAST of FC931067 vs. ExPASy Swiss-Prot
Match: I5P2_HUMAN (Type II inositol-1,4,5-trisphosphate 5-phosphatase OS=Homo sapiens GN=INPP5B PE=1 SV=4)

HSP 1 Score: 121.324 bits (303), Expect = 5.195e-27
Identity = 64/145 (44.14%), Postives = 89/145 (61.38%), Query Frame = 1
Query:   13 PQTSPSHDQIFWFGDLNYRLNMMDTE-VRELVAQKRWDKLINSDQLSKELHSGHVFEGWKEGVINFPPTYKYEINSDRYVGENPKEGEKKRSPAWCDRILWLGKGIKQLAY-TRAEILLSDHRPVSSTFLVQVEVLDHRKLKRAL 441
            P T  +HD I W GDLNYR+  +D E V++L+ +K +  L   DQL  ++ +  VFEG+ EG + F PTYKY+  SD +        EK R+PAWCDRILW GK I QL+Y +   +  SDH+PVSS F + V V++    ++ L
Sbjct:  513 PLTISNHDVILWLGDLNYRIEELDVEKVKKLIEEKDFQMLYAYDQLKIQVAAKTVFEGFTEGELTFQPTYKYDTGSDDW-----DTSEKCRAPAWCDRILWKGKNITQLSYQSHMALKTSDHKPVSSVFDIGVRVVNDELYRKTL 652          
BLAST of FC931067 vs. ExPASy Swiss-Prot
Match: OCRL_HUMAN (Inositol polyphosphate 5-phosphatase OCRL-1 OS=Homo sapiens GN=OCRL PE=1 SV=3)

HSP 1 Score: 111.309 bits (277), Expect = 5.375e-24
Identity = 59/146 (40.41%), Postives = 85/146 (58.22%), Query Frame = 1
Query:   31 HDQIFWFGDLNYRLNMMDT-EVRELVAQKRWDKLINSDQLSKELHSGHVFEGWKEGVINFPPTYKYEINSDRYVGENPKEGEKKRSPAWCDRILWLGKGIKQLAY-TRAEILLSDHRPVSSTFLVQVEVLDHRKLKRALNVSSAVV 462
            H+ + W GDLNYRL M D  EV+ L+ +K   +L+  DQL+ +      F  + EG I F PTYKY+  +DR+         K R PAWCDRILW G  + QL Y +  E+  SDH+PVS+ F + V+V+D R+ ++    S  ++
Sbjct:  414 HEVVIWLGDLNYRLCMPDANEVKSLINKKDLQRLLKFDQLNIQRTQKKAFVDFNEGEIKFIPTYKYDSKTDRW-----DSSGKCRVPAWCDRILWRGTNVNQLNYRSHMELKTSDHKPVSALFHIGVKVVDERRYRKVFEDSVRIM 554          
BLAST of FC931067 vs. ExPASy Swiss-Prot
Match: SYNJ1_HUMAN (Synaptojanin-1 OS=Homo sapiens GN=SYNJ1 PE=1 SV=2)

HSP 1 Score: 110.153 bits (274), Expect = 1.198e-23
Identity = 60/159 (37.74%), Postives = 85/159 (53.46%), Query Frame = 1
Query:   28 SHDQIFWFGDLNYRLNMMDTEVRELVAQKRWDKLINSDQLSKELHSGHVFEGWKEGVINFPPTYKYEINSDRYVGENPKEGEKKRSPAWCDRILW----------------LGKGIKQ-------------LAYTRAEILLSDHRPVSSTFLVQVEVLD 417
            SHD +FW GD NYR+++ + EV+EL+ Q+ WD LI  DQL  + ++G VF G+ EG + F PTYKY++ SD Y        EK R+PAW DR+LW                L    +              L Y RAE+  SDHRPV +  L+ +++ +
Sbjct:  721 SHDYVFWCGDFNYRIDLPNEEVKELIRQQNWDSLIAGDQLINQKNAGQVFRGFLEGKVTFAPTYKYDLFSDDY-----DTSEKCRTPAWTDRVLWRRRKWPFDRSAEDLDLLNASFQDESKILYTWTPGTLLHYGRAELKTSDHRPVVA--LIDIDIFE 872          
BLAST of FC931067 vs. ExPASy Swiss-Prot
Match: SYNJ1_BOVIN (Synaptojanin-1 (Fragment) OS=Bos taurus GN=SYNJ1 PE=1 SV=2)

HSP 1 Score: 109.768 bits (273), Expect = 1.564e-23
Identity = 59/159 (37.11%), Postives = 85/159 (53.46%), Query Frame = 1
Query:   28 SHDQIFWFGDLNYRLNMMDTEVRELVAQKRWDKLINSDQLSKELHSGHVFEGWKEGVINFPPTYKYEINSDRYVGENPKEGEKKRSPAWCDRILW----------------LGKGIKQ-------------LAYTRAEILLSDHRPVSSTFLVQVEVLD 417
            SHD +FW GD NYR+++ + EV+EL+ Q+ WD LI  DQL  + ++G +F G+ EG + F PTYKY++ SD Y        EK R+PAW DR+LW                L    +              L Y RAE+  SDHRPV +  L+ +++ +
Sbjct:  721 SHDYVFWCGDFNYRIDLPNEEVKELIRQQNWDSLIAGDQLINQKNAGQIFRGFLEGKVTFAPTYKYDLFSDDY-----DTSEKCRTPAWTDRVLWRRRKWPFDRSAEDLDLLNASFQDESKILYTWTPGTLLHYGRAELKTSDHRPVVA--LIDIDIFE 872          
BLAST of FC931067 vs. ExPASy Swiss-Prot
Match: SYNJ1_RAT (Synaptojanin-1 OS=Rattus norvegicus GN=Synj1 PE=1 SV=3)

HSP 1 Score: 108.227 bits (269), Expect = 4.551e-23
Identity = 58/159 (36.48%), Postives = 85/159 (53.46%), Query Frame = 1
Query:   28 SHDQIFWFGDLNYRLNMMDTEVRELVAQKRWDKLINSDQLSKELHSGHVFEGWKEGVINFPPTYKYEINSDRYVGENPKEGEKKRSPAWCDRILW----------------LGKGIKQ-------------LAYTRAEILLSDHRPVSSTFLVQVEVLD 417
            SHD +FW GD NYR+++ + EV+EL+ Q+ WD LI  DQL  + ++G +F G+ EG + F PTYKY++ S+ Y        EK R+PAW DR+LW                L    +              L Y RAE+  SDHRPV +  L+ +++ +
Sbjct:  721 SHDYVFWCGDFNYRIDLPNEEVKELIRQQNWDSLIAGDQLINQKNAGQIFRGFLEGKVTFAPTYKYDLFSEDY-----DTSEKCRTPAWTDRVLWRRRKWPFDRSAEDLDLLNASFQDESKILYTWTPGTLLHYGRAELKTSDHRPVVA--LIDIDIFE 872          
The following BLAST results are available for this feature:
BLAST of FC931067 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 42
Match NameE-valueIdentityDescription
IP5P2_ARATH1.546e-6371.07Type I inositol-1,4,5-trisphosphate 5-phosphatase ... [more]
IP5P1_ARATH4.230e-4553.33Type I inositol-1,4,5-trisphosphate 5-phosphatase ... [more]
IP5P3_ARATH3.835e-3847.71Type I inositol-1,4,5-trisphosphate 5-phosphatase ... [more]
INP52_YEAST1.785e-2742.86Inositol-1,4,5-trisphosphate 5-phosphatase 2 OS=Sa... [more]
INP53_YEAST2.332e-2740.65Inositol-1,4,5-trisphosphate 5-phosphatase 3 OS=Sa... [more]
I5P2_HUMAN5.195e-2744.14Type II inositol-1,4,5-trisphosphate 5-phosphatase... [more]
OCRL_HUMAN5.375e-2440.41Inositol polyphosphate 5-phosphatase OCRL-1 OS=Hom... [more]
SYNJ1_HUMAN1.198e-2337.74Synaptojanin-1 OS=Homo sapiens GN=SYNJ1 PE=1 SV=2[more]
SYNJ1_BOVIN1.564e-2337.11Synaptojanin-1 (Fragment) OS=Bos taurus GN=SYNJ1 P... [more]
SYNJ1_RAT4.551e-2336.48Synaptojanin-1 OS=Rattus norvegicus GN=Synj1 PE=1 ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101A10EF PostHarvP1 Citrus clementina cDNA clone C34101A10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931067 ID=FC931067|Name=FC931067|organism=Citrus clementina|type=EST|length=723bp
GGAACAGATCAACCACAGACATCTCCATCTCATGATCAGATATTCTGGTT
TGGGGATTTGAATTATCGTCTCAATATGATGGACACAGAAGTTCGGGAGC
TTGTTGCTCAGAAGCGGTGGGATAAGCTTATCAACAGTGATCAGCTAAGC
AAAGAACTCCACAGTGGGCATGTGTTTGAGGGATGGAAAGAGGGAGTGAT
AAACTTTCCACCAACTTACAAATACGAAATAAATTCTGATAGATATGTTG
GTGAGAACCCAAAAGAAGGGGAGAAGAAAAGATCTCCAGCATGGTGTGAT
CGTATACTTTGGCTAGGAAAAGGCATAAAACAACTTGCTTACACGCGGGC
AGAGATACTACTCTCTGATCATCGGCCTGTTAGTTCAACGTTCTTGGTTC
AAGTTGAGGTCTTAGACCATCGAAAGTTGAAGAGAGCACTCAATGTCAGC
TCTGCAGTAGTACATCCTGATATTTTCTTAGATGAAGATGGGGAACTAGA
GCTTCAGCAATTACCAGGTAGAATACCAGGGGACCGCAAGTTGTTTGGCT
AACATTAGAAGTTGACATCAAATCGATATACGGGTATCGACATCCACCTT
CAGGTTGAAGCACGAACAAAATCAAATCCTTGTGACAATAGCAAGGAAAA
GAAGTGTTCTGTATAGCCTTGAGTCACATAATACTTGATACATAGTCAAT
ATATAGATATAGCAATGTGCCAA
back to top