FC931070

Overview
NameFC931070
Unique NameFC931070
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length383
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig11029 contig Ccv1_Contig11029:112..494. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931070 vs. ExPASy Swiss-Prot
Match: LGT_CITUN (Limonoid UDP-glucosyltransferase OS=Citrus unshiu PE=2 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 6.173e-13
Identity = 43/99 (43.43%), Postives = 56/99 (56.57%), Query Frame = 1
Query:   76 HVLMVSLATQSHINPLLRLGKRLVSKGLSVTVATPEIAQHQLLKSFTSSKINDCVSDD-IPCLFFSDGFDLDYNRKSDLDHYMETIEKAGPGNLSKLIK 369
            HVL+VS     H+NPLLRLG+ L SKG  +T+ TPE    Q+ K+   +     V D  I   FF DG+D D  R+ DLD YM  +E  G   + K+IK
Sbjct:    8 HVLLVSFPGHGHVNPLLRLGRLLASKGFFLTLTTPESFGKQMRKAGNFTYEPTPVGDGFIRFEFFEDGWDEDDPRREDLDQYMAQLELIGKQVIPKIIK 106          
The following BLAST results are available for this feature:
BLAST of FC931070 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
LGT_CITUN6.173e-1343.43Limonoid UDP-glucosyltransferase OS=Citrus unshiu ... [more]
back to top
Properties
Property NameValue
Genbank descriptionC34101B01EF PostHarvP1 Citrus clementina cDNA clone C34101B01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931070 ID=FC931070|Name=FC931070|organism=Citrus clementina|type=EST|length=383bp
GATAGCCTCATCTTTATTCTTCTTCTTTCCAGGAGCAGTCAAATGGATTT
GAAAGAGGAAAAAGAATATGGTCATCATGTGCTAATGGTATCACTCGCGA
CCCAAAGTCATATTAATCCCTTGCTTAGACTTGGCAAACGCCTAGTCTCT
AAAGGTCTCAGTGTAACGGTTGCCACACCTGAAATTGCCCAACACCAATT
GCTCAAATCATTCACCAGCAGCAAAATCAATGATTGTGTTTCTGATGATA
TCCCATGTCTATTTTTCTCCGATGGGTTCGATTTAGATTACAACCGCAAA
TCCGATTTAGATCACTACATGGAAACTATAGAGAAAGCTGGACCTGGTAA
CCTCTCAAAACTTATCAAAAATCATTACCATGA
back to top