FC931075

Overview
NameFC931075
Unique NameFC931075
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length707
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig4305 contig Ccv1_Contig4305:78..784. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931075 vs. ExPASy Swiss-Prot
Match: Y3028_ARATH (Uncharacterized acetyltransferase At3g50280 OS=Arabidopsis thaliana GN=At3g50280 PE=1 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 1.664e-30
Identity = 82/215 (38.14%), Postives = 125/215 (58.14%), Query Frame = 1
Query:   61 VQYMSECFVQPEYFSEEMKQPCYLTPWDLVMLSVQYIQKGLLFRKPAIPPASGDQVDFIKTLLDRLKHSLSLTLVHFYPLAGRLATRRTDSPPSYVVFVDCNNSPGAKFIHASLD-MAISDILSPT-YVPLVVQSFFDHDRALNHDGHSRPLLSIQVTELVDGIFIGCSMNHVLGDGTSFWNFFNAFSEIFQAQGKMASISRPPVVKRWFPDGRD 699
            V ++S   V+P+  ++E ++  +LTP+DL +L V Y Q+GLLF KP          D     + RL+ SLS  L  ++P AGRL         +   +++C+ S GAKFIHA  D +++SD+L P   VP   + F+  +   + DG S PLL++QVTE+ DG+FIG   NH++ DG S WNFF  +S+I  + G+  ++ +P  +K  F DG D
Sbjct:    4 VTFISSSIVRPQIINQEGREKIHLTPFDLNLLYVDYTQRGLLFPKP----------DPETHFISRLRTSLSSALDIYFPFAGRLNKVENHEDETVSFYINCDGS-GAKFIHAVSDSVSVSDLLRPDGSVPDFFRIFYPMNGVKSIDGLSEPLLALQVTEMRDGVFIGFGYNHMVADGASIWNFFRTWSKIC-SNGQRENL-QPLALKGLFVDGMD 205          
BLAST of FC931075 vs. ExPASy Swiss-Prot
Match: DCR_ARATH (BAHD acyltransferase DCR OS=Arabidopsis thaliana GN=DCR PE=2 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 6.788e-16
Identity = 68/208 (32.69%), Postives = 106/208 (50.96%), Query Frame = 1
Query:   61 VQYMSECFVQPEYFSEEMKQPCYLTPWDLVMLSVQYIQKGLLFRKPAIPPASGDQVDFIKTLLDRLKHSLSLTLVHFYPLAGRLATRRTDSPPSYVVFVDCNNSP--GAKFIHASLDMAISDILSPTYVPLVVQSFFDHDRALNHDGHSRPLLSIQVTELVDGIFIGCSMNHVLGDGTSFWNFFNAFSEIFQAQGKMASISRPPVVKR 678
            ++ MS+  V+P       KQ  +LT +DL  L+  Y QK LL++   +     ++  F   +++ LK  L L L  FY LAG+LA    D    + V  D  +S   G +F  A       D L+        +    ++  LN +G SRPLL++QVT+L DG+ +G + NH + DGTS W+F ++++EI +      SIS  P + R
Sbjct:    3 IKIMSKTHVKPTKPVLGKKQ-FHLTTFDLPYLAFYYNQKFLLYKFQNLLDL--EEPTFQNEVVENLKDGLGLVLEDFYQLAGKLAK---DDEGVFRVEYDAEDSEINGVEFSVAHAADVTVDDLTAEDGTAKFKELVPYNGILNLEGLSRPLLAVQVTKLKDGLAMGLAFNHAVLDGTSTWHFMSSWAEICRG---AQSISTQPFLDR 201          
The following BLAST results are available for this feature:
BLAST of FC931075 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
Y3028_ARATH1.664e-3038.14Uncharacterized acetyltransferase At3g50280 OS=Ara... [more]
DCR_ARATH6.788e-1632.69BAHD acyltransferase DCR OS=Arabidopsis thaliana G... [more]
back to top
Properties
Property NameValue
Genbank descriptionC34101B07EF PostHarvP1 Citrus clementina cDNA clone C34101B07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931075 ID=FC931075|Name=FC931075|organism=Citrus clementina|type=EST|length=707bp
GAAAGACCAAATAGAAAAAAGTAGATAGCTTTGCTTGAGCGAAGGATGAA
TTCCCCAGCAGTTCAATACATGTCAGAATGCTTTGTCCAGCCAGAGTACT
TTTCAGAGGAGATGAAACAGCCCTGTTACTTGACACCATGGGATCTAGTA
ATGCTATCCGTACAATATATCCAGAAGGGCCTTCTCTTTAGGAAACCAGC
GATACCACCAGCATCAGGTGATCAAGTTGACTTCATCAAGACTCTCCTAG
ACAGGCTTAAGCACTCCCTGTCCCTCACCCTTGTTCATTTCTACCCTCTA
GCCGGGCGCCTCGCCACACGACGGACCGATAGCCCGCCTTCTTATGTGGT
CTTTGTTGATTGCAATAACAGCCCTGGTGCTAAGTTTATCCATGCGTCTT
TAGACATGGCAATATCCGACATCCTTTCACCTACTTATGTTCCTTTGGTG
GTCCAATCCTTTTTTGACCATGATAGAGCTTTGAACCATGATGGTCATTC
AAGGCCTCTGCTATCAATTCAGGTGACAGAGCTGGTTGATGGCATCTTCA
TAGGTTGTTCAATGAACCATGTCTTGGGTGATGGAACCTCTTTTTGGAAT
TTCTTCAACGCGTTTTCTGAAATCTTTCAAGCACAAGGAAAGATGGCTTC
CATCTCGCGCCCGCCAGTCGTAAAACGCTGGTTTCCAGACGGACGCGATC
CAATTAT
back to top