FC931077

Overview
NameFC931077
Unique NameFC931077
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length704
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15266 contig Ccv1_Contig15266:1..704. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: TCMO_POPKI (Trans-cinnamate 4-monooxygenase OS=Populus kitakamiensis GN=CYP73A16 PE=2 SV=1)

HSP 1 Score: 451.055 bits (1159), Expect = 2.738e-126
Identity = 216/234 (92.31%), Postives = 228/234 (97.44%), Query Frame = 2
Query:    2 LMMYNNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            LMMYNNMYRIMFDRRFES+DDPLFN+LKALNGERSRLAQSF+YNYGDFIPILRPFLRGYLKIC+EVKERRLQLFKDYFV+ERKKLASTK+MSNE LKCAIDHILDAQ KGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLR+ELDT+LGPGHQITEPDT+KLPYL AV+KETLRLRMAIPLLVPHMNLHDAKLGG+D+PAESKILVNAWWLAN PA WK P
Sbjct:  180 LMMYNNMYRIMFDRRFESEDDPLFNKLKALNGERSRLAQSFDYNYGDFIPILRPFLRGYLKICQEVKERRLQLFKDYFVDERKKLASTKNMSNEGLKCAIDHILDAQKKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRHELDTLLGPGHQITEPDTYKLPYLNAVVKETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKILVNAWWLANNPAHWKNP 413          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: TCMO_POPTM (Trans-cinnamate 4-monooxygenase OS=Populus tremuloides GN=CYP73A13 PE=2 SV=1)

HSP 1 Score: 447.588 bits (1150), Expect = 3.028e-125
Identity = 214/234 (91.45%), Postives = 227/234 (97.01%), Query Frame = 2
Query:    2 LMMYNNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            LMMYNNMYRIMFDRRFES++DPLFN+LKALNGERSRLAQSF+YNYGDFIPILRPFLRGYLKIC+EVKERRLQLFKDYFV+ERKKLASTK+M NE LKCAIDHILDAQ KGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLR+ELDT+LGPGHQITEPDT+KLPYL AV+KETLRLRMAIPLLVPHMNLHDAKLGG+D+PAESKILVNAWWLAN PA WK P
Sbjct:  180 LMMYNNMYRIMFDRRFESEEDPLFNKLKALNGERSRLAQSFDYNYGDFIPILRPFLRGYLKICQEVKERRLQLFKDYFVDERKKLASTKNMCNEGLKCAIDHILDAQKKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRHELDTLLGPGHQITEPDTYKLPYLNAVVKETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKILVNAWWLANNPAHWKNP 413          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: TCMO_GLYEC (Trans-cinnamate 4-monooxygenase OS=Glycyrrhiza echinata GN=CYP73A14 PE=2 SV=1)

HSP 1 Score: 438.728 bits (1127), Expect = 1.406e-122
Identity = 211/234 (90.17%), Postives = 223/234 (95.30%), Query Frame = 2
Query:    2 LMMYNNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            LMMYNNMYRIMFDRRFES++DPLF +LKALNGERSRLAQSFEYNYGDFIPILRPFL+GYLKICKEVKERRL+LFKDYFV+ER KL STKS SNE LKCAIDHILDAQ KGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKK+R+E+D VLGPGHQ+TEPD  KLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYD+PAESKILVNAWWLAN PA WK+P
Sbjct:  180 LMMYNNMYRIMFDRRFESEEDPLFVKLKALNGERSRLAQSFEYNYGDFIPILRPFLKGYLKICKEVKERRLKLFKDYFVDERMKLESTKSTSNEGLKCAIDHILDAQKKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKVRDEIDRVLGPGHQVTEPDMQKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPANWKRP 413          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: TCMO_CATRO (Trans-cinnamate 4-monooxygenase OS=Catharanthus roseus GN=CYP73A4 PE=2 SV=1)

HSP 1 Score: 434.876 bits (1117), Expect = 2.031e-121
Identity = 211/234 (90.17%), Postives = 222/234 (94.87%), Query Frame = 2
Query:    2 LMMYNNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            LMMYNNMYRIMFDRRFES+DDPLF +LKALNGERSRLAQ FEYNYGDFIPILRPFLRGYL+ICKEVKERRLQLFKDYFV+ERKK  STKSM N SLKCAIDHIL+AQ KGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLR+EL+TVLGPG QITEPDT+KLPYLQAVIKETLRLRMAIPL +PHMNLHDAKLGGYD+PAESKILVNAW+LAN P  WKKP
Sbjct:  180 LMMYNNMYRIMFDRRFESEDDPLFVKLKALNGERSRLAQGFEYNYGDFIPILRPFLRGYLRICKEVKERRLQLFKDYFVDERKKFGSTKSMDNNSLKCAIDHILEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRDELETVLGPGVQITEPDTYKLPYLQAVIKETLRLRMAIPLFLPHMNLHDAKLGGYDIPAESKILVNAWFLANNPEHWKKP 413          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: TCMO_RUTGR (Trans-cinnamate 4-monooxygenase OS=Ruta graveolens GN=CYP73A2 PE=2 SV=1)

HSP 1 Score: 434.491 bits (1116), Expect = 2.652e-121
Identity = 210/234 (89.74%), Postives = 221/234 (94.44%), Query Frame = 2
Query:    2 LMMYNNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            L+MYNNMYRIMFDRRFES DDPLFN+LKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLK+ KEVKERRL+LFKDYFVEERKKL STKSM+ E+ KCAIDH+LDAQ KGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHP+IQKKLR E+D VLGP HQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL+DAKL GYD+PAESKILVNAWWLAN PA WK P
Sbjct:  180 LLMYNNMYRIMFDRRFESVDDPLFNKLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKLVKEVKERRLKLFKDYFVEERKKLTSTKSMTEENFKCAIDHVLDAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPDIQKKLRAEIDRVLGPDHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLNDAKLAGYDIPAESKILVNAWWLANNPAHWKDP 413          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: TCMO_PHAAU (Trans-cinnamate 4-monooxygenase OS=Phaseolus aureus GN=CYP73A2 PE=1 SV=1)

HSP 1 Score: 432.18 bits (1110), Expect = 1.316e-120
Identity = 206/234 (88.03%), Postives = 221/234 (94.44%), Query Frame = 2
Query:    2 LMMYNNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            LMMYNNMYRIMFDRRFES++DPLF RLKALNGERSRLAQSFEYNYGDFIPILRPFL+GYLKICKEVKE RL+LFKDYFV+ERK + STKS +NE LKCAIDHILDA+ KGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQ+K+R+E+D VLG GHQ+TEPD  KLPYLQAV+KETLRLRMAIPLLVPHMNLHDAKLGGYD+PAESKILVNAWWLAN PA WKKP
Sbjct:  180 LMMYNNMYRIMFDRRFESEEDPLFQRLKALNGERSRLAQSFEYNYGDFIPILRPFLKGYLKICKEVKETRLKLFKDYFVDERKNIGSTKSTNNEGLKCAIDHILDAEKKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQQKVRDEIDRVLGVGHQVTEPDIQKLPYLQAVVKETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPAHWKKP 413          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: TCMO_SOYBN (Trans-cinnamate 4-monooxygenase OS=Glycine max GN=CYP73A11 PE=2 SV=1)

HSP 1 Score: 429.483 bits (1103), Expect = 8.532e-120
Identity = 207/235 (88.09%), Postives = 222/235 (94.47%), Query Frame = 2
Query:    2 LMMYNNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNES-LKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            LMMYNNMYRIMFDRRFES++DP+F RL+ALNGERSRLAQSFEYNYGDFIPILRPFL+GYLKICKEVKE RL+LFKDYFV+ERKKL STKS +N + LKCAIDHILDAQ KGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQ+KLR+E+D VLG GHQ+TEPD  KLPYLQAV+KETLRLRMAIPLLVPHMNLHDAKLGGYD+PAESKILVNAWWLAN PA WKKP
Sbjct:  180 LMMYNNMYRIMFDRRFESEEDPIFQRLRALNGERSRLAQSFEYNYGDFIPILRPFLKGYLKICKEVKETRLKLFKDYFVDERKKLGSTKSTNNNNELKCAIDHILDAQRKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQQKLRDEIDRVLGAGHQVTEPDIQKLPYLQAVVKETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPAHWKKP 414          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: TCMO_PEA (Trans-cinnamate 4-monooxygenase OS=Pisum sativum GN=CYP73A9 PE=2 SV=2)

HSP 1 Score: 429.483 bits (1103), Expect = 8.532e-120
Identity = 207/234 (88.46%), Postives = 219/234 (93.59%), Query Frame = 2
Query:    2 LMMYNNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            LMMYN MYRIMFDRRFES++DPLF +LKALNGERSRLAQSFEYNYGDFIPILRPFL+GYLK+CKEVK+RRLQLFKDYFV+ERKKL STKS  NE LKCAIDHILDAQ KGEIN+DNVLYIVENINVAAIETTLWSIEWGIAELVNH EIQ KLR E+D VLGPGHQ+TEPD  KLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGG+D+PAESKILVNAWWLAN PA WKKP
Sbjct:  180 LMMYNIMYRIMFDRRFESEEDPLFVKLKALNGERSRLAQSFEYNYGDFIPILRPFLKGYLKVCKEVKDRRLQLFKDYFVDERKKLGSTKSTYNEGLKCAIDHILDAQKKGEINDDNVLYIVENINVAAIETTLWSIEWGIAELVNHQEIQNKLREEMDKVLGPGHQVTEPDLEKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKILVNAWWLANNPALWKKP 413          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: TCMO_CICAR (Trans-cinnamate 4-monooxygenase OS=Cicer arietinum GN=CYP73A19 PE=2 SV=2)

HSP 1 Score: 426.017 bits (1094), Expect = 9.433e-119
Identity = 204/234 (87.18%), Postives = 219/234 (93.59%), Query Frame = 2
Query:    2 LMMYNNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            LMMYN MYRIMFDRRFES++DPLF +LKALNGERSRLAQSFEYNYGDFIPILRPFL+GYLK+CKEVK+RRLQLFKDYFV+ERKKL STKS +NE LKCAIDHILDAQ KGEIN+DNVLYIVENINVAAIETTLWSIEWGIAELVNH +IQ K+R E+D VLGPGHQ+TEPD  KLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKL G+D+PAESKILVNAWWLAN PA WKKP
Sbjct:  179 LMMYNIMYRIMFDRRFESEEDPLFVKLKALNGERSRLAQSFEYNYGDFIPILRPFLKGYLKLCKEVKDRRLQLFKDYFVDERKKLGSTKSTTNEGLKCAIDHILDAQQKGEINDDNVLYIVENINVAAIETTLWSIEWGIAELVNHQKIQNKVREEIDRVLGPGHQVTEPDLQKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLSGFDIPAESKILVNAWWLANNPAQWKKP 412          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: TCMO_ZINEL (Trans-cinnamate 4-monooxygenase OS=Zinnia elegans GN=CYP73A12 PE=2 SV=1)

HSP 1 Score: 425.246 bits (1092), Expect = 1.609e-118
Identity = 205/234 (87.61%), Postives = 217/234 (92.74%), Query Frame = 2
Query:    2 LMMYNNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            LMMYNNM+RIMFDRRFES+DDPLF +LK LNGERSRLAQSFEYNYGDFIPILRPFL+GYLK+CKEVKE+R QLFKDYFV+ERKKL STKSM N  LKCAIDHILDA+ KGEINEDNVLYIVENINVAAIETTLWSIEW IAELVNHPEIQ KLR+EL + LGPG Q+TEPD HKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYD+PAESKILVNAWWLAN P  WKKP
Sbjct:  180 LMMYNNMFRIMFDRRFESEDDPLFVKLKMLNGERSRLAQSFEYNYGDFIPILRPFLKGYLKLCKEVKEKRFQLFKDYFVDERKKLGSTKSMDNNQLKCAIDHILDAKDKGEINEDNVLYIVENINVAAIETTLWSIEWAIAELVNHPEIQAKLRHELVSQLGPGVQVTEPDLHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPDQWKKP 413          
The following BLAST results are available for this feature:
BLAST of FC931077 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 311
Match NameE-valueIdentityDescription
TCMO_POPKI2.738e-12692.31Trans-cinnamate 4-monooxygenase OS=Populus kitakam... [more]
TCMO_POPTM3.028e-12591.45Trans-cinnamate 4-monooxygenase OS=Populus tremulo... [more]
TCMO_GLYEC1.406e-12290.17Trans-cinnamate 4-monooxygenase OS=Glycyrrhiza ech... [more]
TCMO_CATRO2.031e-12190.17Trans-cinnamate 4-monooxygenase OS=Catharanthus ro... [more]
TCMO_RUTGR2.652e-12189.74Trans-cinnamate 4-monooxygenase OS=Ruta graveolens... [more]
TCMO_PHAAU1.316e-12088.03Trans-cinnamate 4-monooxygenase OS=Phaseolus aureu... [more]
TCMO_SOYBN8.532e-12088.09Trans-cinnamate 4-monooxygenase OS=Glycine max GN=... [more]
TCMO_PEA8.532e-12088.46Trans-cinnamate 4-monooxygenase OS=Pisum sativum G... [more]
TCMO_CICAR9.433e-11987.18Trans-cinnamate 4-monooxygenase OS=Cicer arietinum... [more]
TCMO_ZINEL1.609e-11887.61Trans-cinnamate 4-monooxygenase OS=Zinnia elegans ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101B09EF PostHarvP1 Citrus clementina cDNA clone C34101B09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931077 ID=FC931077|Name=FC931077|organism=Citrus clementina|type=EST|length=704bp
GCTTATGATGTACAACAACATGTACAGGATTATGTTTGATAGAAGATTCG
AGAGTCAGGATGATCCTTTGTTTAACAGATTAAAGGCTTTGAATGGTGAG
AGGAGTCGGTTGGCCCAGAGCTTTGAGTACAATTACGGTGATTTTATTCC
CATTTTGAGACCTTTCTTGAGAGGCTACTTGAAGATTTGTAAGGAAGTTA
AAGAAAGGAGACTCCAGCTCTTCAAGGACTACTTTGTTGAGGAGAGAAAG
AAATTGGCAAGCACGAAGAGCATGAGTAATGAAAGCTTGAAATGCGCAAT
CGATCATATTTTGGACGCTCAGACAAAGGGAGAAATCAACGAGGACAACG
TTCTATACATCGTTGAGAACATCAATGTTGCCGCGATCGAGACAACTCTT
TGGTCGATCGAGTGGGGAATTGCAGAGCTAGTGAATCATCCTGAAATCCA
GAAGAAGCTCCGCAATGAACTTGACACCGTGCTTGGTCCTGGTCATCAAA
TCACTGAGCCTGACACCCACAAACTACCCTACCTTCAGGCCGTGATCAAG
GAAACTCTTCGCCTTAGGATGGCAATTCCTCTTCTTGTGCCGCACATGAA
CCTTCACGACGCCAAGCTTGGAGGCTACGACGTCCCTGCTGAGAGCAAAA
TCCTAGTGAACGCGTGGTGGCTCGCCAACNATCCCGCCCCATGGAAGAAA
CCTG
back to top