FC931078

Overview
NameFC931078
Unique NameFC931078
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length702
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15267 contig Ccv1_Contig15267:1..702. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931078 vs. ExPASy Swiss-Prot
Match: PSD12_PONAB (26S proteasome non-ATPase regulatory subunit 12 OS=Pongo abelii GN=PSMD12 PE=2 SV=3)

HSP 1 Score: 173.711 bits (439), Expect = 8.438e-43
Identity = 84/186 (45.16%), Postives = 126/186 (67.74%), Query Frame = 1
Query:  142 SKMEGKGNLEAQVDQLLNTEKQMRLSGDVAGTKKAVTEILQLCFEAKDWKTLNEQIVNLSKKRGQLKXXXXXXXXXXXXYIDQTPDLDTRIELIKTLNSVSAGKIYVEIERARLIKKLAKIKEEQGLIAEAADLMQEVAVETFGAMAKTEKIAFILEQVRLCLDRQDYVRAQILSRKISPRVFDAD 699
            +K+  +G L+  ++ LL+ EKQ R + D+  T + +  ++++C+EAK+W  LNE I+ LSK+R QLK            Y+++  DL  ++ LI TL  V+ GKIYVEIERARL K LA IKE+ G + EAA ++QE+ VET+G+M K E++ FILEQ+RLCL  +DY+R QI+S+KI+ + F  +
Sbjct:   32 AKLAKEGRLQEVIETLLSLEKQTRTASDMVSTSRILVAVVKMCYEAKEWDLLNENIMLLSKRRSQLKQAVAKMVQQCCTYVEEITDLPIKLRLIDTLRMVTEGKIYVEIERARLTKTLATIKEQNGDVKEAASILQELQVETYGSMEKKERVEFILEQMRLCLAVKDYIRTQIISKKINTKFFQEE 217          
BLAST of FC931078 vs. ExPASy Swiss-Prot
Match: PSD12_HUMAN (26S proteasome non-ATPase regulatory subunit 12 OS=Homo sapiens GN=PSMD12 PE=1 SV=3)

HSP 1 Score: 173.711 bits (439), Expect = 8.438e-43
Identity = 84/186 (45.16%), Postives = 126/186 (67.74%), Query Frame = 1
Query:  142 SKMEGKGNLEAQVDQLLNTEKQMRLSGDVAGTKKAVTEILQLCFEAKDWKTLNEQIVNLSKKRGQLKXXXXXXXXXXXXYIDQTPDLDTRIELIKTLNSVSAGKIYVEIERARLIKKLAKIKEEQGLIAEAADLMQEVAVETFGAMAKTEKIAFILEQVRLCLDRQDYVRAQILSRKISPRVFDAD 699
            +K+  +G L+  ++ LL+ EKQ R + D+  T + +  ++++C+EAK+W  LNE I+ LSK+R QLK            Y+++  DL  ++ LI TL  V+ GKIYVEIERARL K LA IKE+ G + EAA ++QE+ VET+G+M K E++ FILEQ+RLCL  +DY+R QI+S+KI+ + F  +
Sbjct:   32 AKLAKEGRLQEVIETLLSLEKQTRTASDMVSTSRILVAVVKMCYEAKEWDLLNENIMLLSKRRSQLKQAVAKMVQQCCTYVEEITDLPIKLRLIDTLRMVTEGKIYVEIERARLTKTLATIKEQNGDVKEAASILQELQVETYGSMEKKERVEFILEQMRLCLAVKDYIRTQIISKKINTKFFQEE 217          
BLAST of FC931078 vs. ExPASy Swiss-Prot
Match: PSD12_BOVIN (26S proteasome non-ATPase regulatory subunit 12 OS=Bos taurus GN=PSMD12 PE=2 SV=3)

HSP 1 Score: 173.711 bits (439), Expect = 8.438e-43
Identity = 85/185 (45.95%), Postives = 125/185 (67.57%), Query Frame = 1
Query:  145 KMEGKGNLEAQVDQLLNTEKQMRLSGDVAGTKKAVTEILQLCFEAKDWKTLNEQIVNLSKKRGQLKXXXXXXXXXXXXYIDQTPDLDTRIELIKTLNSVSAGKIYVEIERARLIKKLAKIKEEQGLIAEAADLMQEVAVETFGAMAKTEKIAFILEQVRLCLDRQDYVRAQILSRKISPRVFDAD 699
            K+  +G L+  ++ LL+ EKQ R + D+  T + +  I+++C+EAK+W  LNE I+ LSK+R QLK            Y+++  DL  ++ LI TL  V+ GKIYVEIERARL K LA IKE+ G + EAA ++QE+ VET+G+M K E++ FILEQ+RLCL  +DY+R QI+S+KI+ + F  +
Sbjct:   33 KLAKEGRLQEVIETLLSLEKQTRTASDMVSTSRILVAIVKMCYEAKEWDLLNENIMLLSKRRSQLKQAVAKMVQQCCTYVEEITDLPIKLRLIDTLRMVTEGKIYVEIERARLTKTLATIKEQNGDVKEAASILQELQVETYGSMEKKERVEFILEQMRLCLAVKDYIRTQIISKKINTKFFQEE 217          
BLAST of FC931078 vs. ExPASy Swiss-Prot
Match: PSD12_MOUSE (26S proteasome non-ATPase regulatory subunit 12 OS=Mus musculus GN=Psmd12 PE=2 SV=3)

HSP 1 Score: 168.703 bits (426), Expect = 2.714e-41
Identity = 82/180 (45.56%), Postives = 122/180 (67.78%), Query Frame = 1
Query:  145 KMEGKGNLEAQVDQLLNTEKQMRLSGDVAGTKKAVTEILQLCFEAKDWKTLNEQIVNLSKKRGQLKXXXXXXXXXXXXYIDQTPDLDTRIELIKTLNSVSAGKIYVEIERARLIKKLAKIKEEQGLIAEAADLMQEVAVETFGAMAKTEKIAFILEQVRLCLDRQDYVRAQILSRKISPR 684
            K+  +G L+  ++ LL+ EKQ R + D+  T + +  ++++C+EAK+W   NE I+ LSK+R QLK            Y+++  DL  ++ LI TL  V+ GKIYVEIERARL K LA IKE+ G + EAA ++QE+ VET+G+M K E++ FILEQ+RLCL  +DY+R QI+S+KI+ +
Sbjct:   33 KLAKEGRLQEVIETLLSLEKQTRTASDMVSTSRILVAVVKMCYEAKEWDLHNENIMLLSKRRSQLKQAVAKMVQQCCTYVEEITDLPVKLRLIDTLRMVTEGKIYVEIERARLTKTLATIKEQNGDVKEAASILQELQVETYGSMEKKERVEFILEQMRLCLAVKDYIRTQIISKKINTK 212          
BLAST of FC931078 vs. ExPASy Swiss-Prot
Match: PSD12_DICDI (26S proteasome non-ATPase regulatory subunit 12 OS=Dictyostelium discoideum GN=psmD12 PE=2 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 7.392e-39
Identity = 84/197 (42.64%), Postives = 125/197 (63.45%), Query Frame = 1
Query:  124 SPAIIKSKMEGK-----GNLEAQVDQLLNTEKQMRLSGDVAGTKKAVTEILQLCFEAKDWKTLNEQIVNLSKKRGQLKXXXXXXXXXXXXYIDQTPDLDTRIELIKTLNSVSAGKIYVEIERARLIKKLAKIKEEQGLIAEAADLMQEVAVETFGAMAKTEKIAFILEQVRLCLDRQDYVRAQILSRKISPRVFDAD 699
            SP   KS  E +     G L   ++ LL TEKQ R + D   T K   EI++LC+EA     +NE++V LSK+RGQL+            Y+DQ  D+  ++ELI TL ++S GKI+VE ERARL K L+KIKE++G IA AA ++Q++ VET+G M K EKI F ++Q+R+C++ +D++RAQ++  K++ +    D
Sbjct:   22 SPIADKSCKENRELAKSGKLIEAIENLLITEKQCRQAEDSPSTSKIAAEIIKLCYEAGRLDLVNEKLVLLSKRRGQLRPAIKAIVQESMVYVDQITDMKQKLELIDTLRTISDGKIFVENERARLTKTLSKIKEDEGDIASAAKILQDLQVETYGTMEKREKITFFIDQMRICMNNKDFIRAQLIGNKVNRKTLAED 218          
BLAST of FC931078 vs. ExPASy Swiss-Prot
Match: RPN5_YEAST (26S proteasome regulatory subunit RPN5 OS=Saccharomyces cerevisiae GN=RPN5 PE=1 SV=3)

HSP 1 Score: 141.739 bits (356), Expect = 3.553e-33
Identity = 77/180 (42.78%), Postives = 115/180 (63.89%), Query Frame = 1
Query:  157 KGNLEAQVDQLLNTEKQMRLSGDVAGTKKAVTEILQLCFEAKDWKTLNEQIVNLSKKRGQLKXXXXXXXXXXXXYIDQTP--DLDTRIELIKTLNSVSAGKIYVEIERARLIKKLAKIKEEQGLIAEAADLMQEVAVETFGAMAKTEKIAFILEQVRLCLDRQDYVRAQILSRKISPRVF 690
            + +  + +DQLL  EK+ R + D+A +K+ + +I+ L      W  LNEQ+  LSKK GQLK            Y+  +   DL+TRI +I+T+  V+  KI+VE+ERAR+ K L +IK+E+G I EAAD++ E+ VET+G+M  +EKI FILEQ+ L + + DY +A +LSRKI  + F
Sbjct:   29 QNDCNSALDQLLVLEKKTRQASDLASSKEVLAKIVDLLASRNKWDDLNEQLTLLSKKHGQLKLSIQYMIQKVMEYLKSSKSLDLNTRISVIETIRVVTENKIFVEVERARVTKDLVEIKKEEGKIDEAADILCELQVETYGSMEMSEKIQFILEQMELSILKGDYSQATVLSRKILKKTF 208          
BLAST of FC931078 vs. ExPASy Swiss-Prot
Match: RPN5_SCHPO (26S proteasome regulatory subunit rpn5 OS=Schizosaccharomyces pombe GN=rpn5a PE=1 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 4.641e-33
Identity = 77/179 (43.02%), Postives = 114/179 (63.69%), Query Frame = 1
Query:  163 NLEAQVDQLLNTEKQMRLSGDVAGTKKAVTEILQLCFEAKDWKTLNEQIVNLSKKRGQLKXXXXXXXXXXXXYIDQTPDLDTRIELIKTLNSVSAGKIYVEIERARLIKKLAKIKEEQGLIAEAADLMQEVAVETFGAMAKTEKIAFILEQVRLCLDRQDYVRAQILSRKISPRVFDAD 699
            +++A +++LL  EKQ+R + D +   K +  I  L F A D++ LNEQ+V+L KK GQLK            Y+    DL T+I LI+TL +++ GKIYVE+ERARL + L++IKEEQG I  A +++    VET+G+    EK+AFIL+QVRL L R DY  A   ++KI+ + F+ +
Sbjct:   27 DIDANLEKLLIFEKQVRQASDTSTNTKVLIYIADLLFRAGDFQGLNEQLVSLFKKHGQLKQSMTSLVQHVMTYLPGIDDLKTKINLIETLRTITDGKIYVEVERARLTQLLSQIKEEQGDIKSAQEILCNEPVETYGSFDLKEKVAFILDQVRLFLLRSDYYMASTYTKKINVKFFEKE 205          
The following BLAST results are available for this feature:
BLAST of FC931078 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 7
Match NameE-valueIdentityDescription
PSD12_PONAB8.438e-4345.1626S proteasome non-ATPase regulatory subunit 12 OS... [more]
PSD12_HUMAN8.438e-4345.1626S proteasome non-ATPase regulatory subunit 12 OS... [more]
PSD12_BOVIN8.438e-4345.9526S proteasome non-ATPase regulatory subunit 12 OS... [more]
PSD12_MOUSE2.714e-4145.5626S proteasome non-ATPase regulatory subunit 12 OS... [more]
PSD12_DICDI7.392e-3942.6426S proteasome non-ATPase regulatory subunit 12 OS... [more]
RPN5_YEAST3.553e-3342.7826S proteasome regulatory subunit RPN5 OS=Saccharo... [more]
RPN5_SCHPO4.641e-3343.0226S proteasome regulatory subunit rpn5 OS=Schizosa... [more]
back to top
Properties
Property NameValue
Genbank descriptionC34101B10EF PostHarvP1 Citrus clementina cDNA clone C34101B10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931078 ID=FC931078|Name=FC931078|organism=Citrus clementina|type=EST|length=702bp
GGTGTTCAAAGGGTTTATTCCGTTTCCTTTCTTTTCAATTCTTCACCGAA
TCAGAATCCCTCTCTGAACTCACTCTCTGAAAATTAGGGTTTTTTCCCCC
TTATTTAACAATTTTGGGCATAATCTCCGGCGATTATCAAATCGAAGATG
GAGGGTAAAGGCAATTTGGAGGCGCAAGTAGATCAGCTTTTGAATACCGA
GAAGCAGATGAGATTATCCGGTGACGTGGCCGGCACCAAGAAGGCAGTGA
CGGAAATTTTGCAGCTTTGCTTTGAAGCTAAAGACTGGAAGACTCTCAAT
GAACAGATTGTTAATCTTTCCAAGAAACGCGGTCAACTCAAGCAGGCTGT
AACTGCAATGGTCCAGCAAGCAATGCAGTACATCGATCAGACGCCAGATC
TTGATACTCGTATAGAGCTCATCAAAACACTAAATAGTGTCTCTGCAGGG
AAGATATATGTTGAAATTGAGAGGGCAAGGTTGATTAAAAAACTTGCAAA
GATTAAGGAAGAACAAGGGCTTATAGCGGAAGCTGCAGATCTGATGCAAG
AAGTGGCTGTGGAGACATTTGGTGCTATGGCAAAAACTGAGAAAATCGCC
TTCATTCTTGAACAAGTCCGTCTGTGCCTAGACCGCCAAGATTATGTCCG
TGCACAAATTCTTTCAAGGAAGATTAGTCCAAGAGTTTTTGATGCTGATC
CT
back to top