FC931083

Overview
NameFC931083
Unique NameFC931083
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length739
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig805 contig Ccv1_Contig805:190..928. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931083 vs. ExPASy Swiss-Prot
Match: LHT1_ARATH (Lysine histidine transporter 1 OS=Arabidopsis thaliana GN=LHT1 PE=1 SV=1)

HSP 1 Score: 407.912 bits (1047), Expect = 2.712e-113
Identity = 197/221 (89.14%), Postives = 210/221 (95.02%), Query Frame = 1
Query:    1 LILSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLYIVVPQQLIVEVGVCIVYMVTGGKSLHKVHELLCKEPCKEIKLSYFIMIFASVHFVLSHLPNFNSIAGVSLAAAVMSLSYSTIAWSASVRKGVQPDVAYGYKAKTAAGTVFNFFSALGDVAFAYAGHNVVLEIQATIPSTPEKPSKGPMWRGVVVAYIVVALCYFPVALIGYWMFGN 663
            L+LSW+ITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLYIVVPQQLIVE+GVCIVYMVTGGKSL K HEL+C + CK IKL+YFIMIFASVHFVLSHLPNFNSI+GVSLAAAVMSLSYSTIAW++S  KGVQ DV YGYKAKT AGTVFNFFS LGDVAFAYAGHNVVLEIQATIPSTPEKPSKGPMWRGV+VAYIVVALCYFPVAL+GY++FGN
Sbjct:   73 LVLSWVITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLYIVVPQQLIVEIGVCIVYMVTGGKSLKKFHELVCDD-CKPIKLTYFIMIFASVHFVLSHLPNFNSISGVSLAAAVMSLSYSTIAWASSASKGVQEDVQYGYKAKTTAGTVFNFFSGLGDVAFAYAGHNVVLEIQATIPSTPEKPSKGPMWRGVIVAYIVVALCYFPVALVGYYIFGN 292          

HSP 2 Score: 22.7126 bits (47), Expect = 2.712e-113
Identity = 10/16 (62.50%), Postives = 12/16 (75.00%), Query Frame = 3
Query:  666 VEDNILLSFGKPHGLL 713
            VEDNIL+S  KP  L+
Sbjct:  294 VEDNILMSLKKPAWLI 309          
BLAST of FC931083 vs. ExPASy Swiss-Prot
Match: LHTL1_ARATH (Lysine histidine transporter-like 1 OS=Arabidopsis thaliana GN=At1g48640 PE=3 SV=2)

HSP 1 Score: 374.015 bits (959), Expect = 4.621e-103
Identity = 186/246 (75.61%), Postives = 207/246 (84.15%), Query Frame = 1
Query:    1 LILSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLYIVVPQQLIVEVGVCIVYMVTGGKSLHKVHELLCKEPCKEIKLSYFIMIFASVHFVLSHLPNFNSIAGVSLAAAVMSLSYSTIAWSASVRKGVQPDVAYGYKAKTAAGTVFNFFSALGDVAFAYAGHNVVLEIQATIPSTPEKPSKGPMWRGVVVAYIVVALCYFPVALIGYWMFGNKLKITSSFPLENHM-AYCMANFLCV 735
            LILSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQ AFGE+LGLYI+VPQQ+IVEVGVCIVYMVTGG+SL K HE+ C++ C  I+LS+FIMIFAS HFVLSHLPNFNSI+GVSL AAVMSLSYSTIAW+A+  KGVQ DV YGYK+ T A TV +FF+ LG +AFAYAGHNVVLEIQATIPSTP  PSKGPMWRGVVVAY+VVALCYFPVAL+GY +FGN +       LE  + A   AN   V
Sbjct:   80 LILSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQFAFGERLGLYIIVPQQIIVEVGVCIVYMVTGGQSLKKFHEIACQD-CSPIRLSFFIMIFASSHFVLSHLPNFNSISGVSLVAAVMSLSYSTIAWTATAAKGVQEDVQYGYKSGTTASTVLSFFTGLGGIAFAYAGHNVVLEIQATIPSTPSNPSKGPMWRGVVVAYVVVALCYFPVALVGYGVFGNAVLDNVLMSLETPVWAIATANLFVV 324          
BLAST of FC931083 vs. ExPASy Swiss-Prot
Match: LHT2_ARATH (Lysine histidine transporter 2 OS=Arabidopsis thaliana GN=LHT2 PE=1 SV=1)

HSP 1 Score: 365.925 bits (938), Expect = 1.259e-100
Identity = 182/246 (73.98%), Postives = 208/246 (84.55%), Query Frame = 1
Query:    1 LILSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLYIVVPQQLIVEVGVCIVYMVTGGKSLHKVHELLCKEPCKEIKLSYFIMIFASVHFVLSHLPNFNSIAGVSLAAAVMSLSYSTIAWSASVRKGVQPDVAYGYKAKTAAGTVFNFFSALGDVAFAYAGHNVVLEIQATIPSTPEKPSKGPMWRGVVVAYIVVALCYFPVALIGYWMFGNKLKITSSFPLENHM-AYCMANFLCV 735
            +++SWIITLYTLWQMVEMHE+VPGKR DRYHELGQHAFGEKLGL+IVVPQQLIVEVGV IVYMVTGG SL KVH+L+C + CKEI+ +++IMIFASVHFV+SHLPNFNSI+ +SLAAAVMSL+YSTIAW+ASV KGV PDV Y  +A T  G VFNF +ALGDVAFAYAGHNVVLEIQATIPSTPE PSK PMWRGV+VAYIVVA+CYFPVA +GY++FGN +       LE  +    MAN   V
Sbjct:   68 MVMSWIITLYTLWQMVEMHEIVPGKRLDRYHELGQHAFGEKLGLWIVVPQQLIVEVGVDIVYMVTGGASLKKVHQLVCPD-CKEIRTTFWIMIFASVHFVISHLPNFNSISIISLAAAVMSLTYSTIAWAASVHKGVHPDVDYSPRASTDVGKVFNFLNALGDVAFAYAGHNVVLEIQATIPSTPEMPSKVPMWRGVIVAYIVVAICYFPVAFLGYYIFGNSVDDNILITLEKPIWLIAMANMFVV 312          
BLAST of FC931083 vs. ExPASy Swiss-Prot
Match: LHTL2_ARATH (Lysine histidine transporter-like 2 OS=Arabidopsis thaliana GN=At1g67640 PE=2 SV=1)

HSP 1 Score: 363.229 bits (931), Expect = 8.157e-100
Identity = 175/223 (78.48%), Postives = 201/223 (90.13%), Query Frame = 1
Query:    1 LILSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLYIVVPQQLIVEVGVCIVYMVTGGKSLHKVHELLCKEPCKEIKLSYFIMIFASVHFVLSHLPNFNSIAGVSLAAAVMSLSYSTIAWSASVRKGVQPDVAYGYKAKTAAGTVFNFFSALGDVAFAYAGHNVVLEIQATIPSTPEKPSKGPMWRGVVVAYIVVALCYFPVALIGYWMFGNKL 669
            +I+SW+IT YTLWQMV+MHEMVPGKRFDRYHELGQHAFGEKLGL+IVVPQQLIVEVGV IVYMVTGGKSL K+H+LLC + CK I+ +Y+IMIFAS+HFVL+HLPNFNSI+ VSLAAAVMSLSYSTIAW+ SV+KGV P+V Y  +A T +G VFNF +ALGDVAFAYAGHNVVLEIQATIPSTPEKPSK  MW+GVVVAYIVVA+CYFPVA + Y++FGN +
Sbjct:   68 MIMSWLITFYTLWQMVQMHEMVPGKRFDRYHELGQHAFGEKLGLWIVVPQQLIVEVGVDIVYMVTGGKSLKKIHDLLCTD-CKNIRTTYWIMIFASIHFVLAHLPNFNSISIVSLAAAVMSLSYSTIAWATSVKKGVHPNVDYSSRASTTSGNVFNFLNALGDVAFAYAGHNVVLEIQATIPSTPEKPSKIAMWKGVVVAYIVVAICYFPVAFVCYYIFGNSV 289          
BLAST of FC931083 vs. ExPASy Swiss-Prot
Match: LHTL3_ARATH (Lysine histidine transporter-like 3 OS=Arabidopsis thaliana GN=At1g61270 PE=3 SV=2)

HSP 1 Score: 323.168 bits (827), Expect = 9.355e-88
Identity = 155/225 (68.89%), Postives = 183/225 (81.33%), Query Frame = 1
Query:    1 LILSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLYIVVPQQLIVEVGVCIVYMVTGGKSLHKVHELLCKE-PCKEIKLSYFIMIFASVHFVLSHLPNFNSIAGVSLAAAVMSLSYSTIAWSASVRKGVQPDVAYGYKAKTAAGTVFNFFSALGDVAFAYAGHNVVLEIQATIPSTPEKPSKGPMWRGVVVAYIVVALCYFPVALIGYWMFGNKLK 672
            LILSW+ITLYT WQM+EMHEM  GKRFDRYHELGQ AFG+KLGLYIVVP QL+VE   CIVYMVTGG+SL K+H+L   +  C+++K+ +FI+IFAS  FVLS L NFNSI+GVSL AAVMS+SYSTIAW AS+ KGV  +V YGYK +        F  ALG++AFAYAGHNVVLEIQATIPSTPE PSK PMW+G +VAYI+VA CYFPVAL+G+W FGN ++
Sbjct:   73 LILSWVITLYTFWQMIEMHEMFEGKRFDRYHELGQAAFGKKLGLYIVVPLQLLVETSACIVYMVTGGESLKKIHQLSVGDYECRKLKVRHFILIFASSQFVLSLLKNFNSISGVSLVAAVMSMSYSTIAWVASLTKGVANNVEYGYKRRNNTSVPLAFLGALGEMAFAYAGHNVVLEIQATIPSTPENPSKRPMWKGAIVAYIIVAFCYFPVALVGFWTFGNNVE 297          
BLAST of FC931083 vs. ExPASy Swiss-Prot
Match: LHTL4_ARATH (Lysine histidine transporter-like 4 OS=Arabidopsis thaliana GN=At3g01760 PE=3 SV=2)

HSP 1 Score: 313.538 bits (802), Expect = 7.412e-85
Identity = 156/227 (68.72%), Postives = 185/227 (81.50%), Query Frame = 1
Query:    1 LILSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLYIVVPQQLIVEVGVCIVYMVTGGKSLHKVHELLC--KEPCKEIKLSYFIMIFASVHFVLSHLPNFNSIAGVSLAAAVMSLSYSTIAWSASVRKGVQP-DVAYGYKAKTAAGTVFNFFSALGDVAFAYAGHNVVLEIQATIPSTPEKPSKGPMWRGVVVAYIVVALCYFPVALIGYWMFGNKLK 672
            LILSW+ITLYTLWQM+EMHEM  G+RFDRYHELGQ AFG+KLGLYI+VP QL+VE+ VCIVYMVTGGKSL  VH+L     + C ++++ +FI+IFAS  FVLS L NFNSI+GVSL AAVMS+SYSTIAW AS+RKG     V YGY+ +T +     F SALG++AFAYAGHNVVLEIQATIPSTPE PSK PMW+G VVAYI+VA CYFPVAL+G+  FGN ++
Sbjct:   71 LILSWVITLYTLWQMIEMHEMFEGQRFDRYHELGQAAFGKKLGLYIIVPLQLLVEISVCIVYMVTGGKSLKNVHDLALGDGDKCTKLRIQHFILIFASSQFVLSLLKNFNSISGVSLVAAVMSVSYSTIAWVASLRKGATTGSVEYGYRKRTTS-VPLAFLSALGEMAFAYAGHNVVLEIQATIPSTPENPSKRPMWKGAVVAYIIVAFCYFPVALVGFKTFGNSVE 296          
BLAST of FC931083 vs. ExPASy Swiss-Prot
Match: LHTL6_ARATH (Lysine histidine transporter-like 6 OS=Arabidopsis thaliana GN=At1g25530 PE=2 SV=1)

HSP 1 Score: 285.419 bits (729), Expect = 2.162e-76
Identity = 138/220 (62.73%), Postives = 170/220 (77.27%), Query Frame = 1
Query:    1 LILSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLYIVVPQQLIVEVGVCIVYMVTGGKSLHKVHELLCKEPCKEIKLSYFIMIFASVHFVLSHLPNFNSIAGVSLAAAVMSLSYSTIAWSASVRKGVQPDVAYGYKAKTAAGTVFNFFSALGDVAFAYAGHNVVLEIQATIPSTPEKPSKGPMWRGVVVAYIVVALCYFPVALIGYWMFG 660
            L ++W +TL T+WQMV++HE VPG RFDRY +LG++AFG KLG +IV+PQQLIV+VG  IVYMVTGGK L +  E+ C   C  ++ SY+I+ F  VHF+LS LPNFNS+AGVSLAAAVMSL YSTIAW  S+  G  PDV+Y YKA       F  F+ALG ++FA+AGH V LEIQAT+PSTPE+PSK PMW+GV+ AY+V A+CYFPVALI YW FG
Sbjct:   67 LAMTWGLTLNTMWQMVQLHECVPGTRFDRYIDLGRYAFGPKLGPWIVLPQQLIVQVGCNIVYMVTGGKCLKQFVEITCST-CTPVRQSYWILGFGGVHFILSQLPNFNSVAGVSLAAAVMSLCYSTIAWGGSIAHGRVPDVSYDYKATNPGDFTFRVFNALGQISFAFAGHAVALEIQATMPSTPERPSKVPMWQGVIGAYVVNAVCYFPVALICYWAFG 285          
BLAST of FC931083 vs. ExPASy Swiss-Prot
Match: LHTL5_ARATH (Lysine histidine transporter-like 5 OS=Arabidopsis thaliana GN=At1g71680 PE=2 SV=2)

HSP 1 Score: 254.988 bits (650), Expect = 3.129e-67
Identity = 131/221 (59.28%), Postives = 164/221 (74.21%), Query Frame = 1
Query:    1 LILSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLYIVVPQQLIVEVGVCIVYMVTGGKSLHKVHELLCKEPCKEIKLSYFIMIFASVHFVLSHLPNFNSIAGVSLAAAVMSLSYSTIAWSASVRKGVQPDVA-YGYKAKTAAGTVFNFFSALGDVAFAYAGHNVVLEIQATIPSTPEKPSKGPMWRGVVVAYIVVALCYFPVALIGYWMFG 660
            +I+SW IT Y+LWQMV++HE VPGKR DRY ELGQ AFG KLG +IV+PQQL+V++   IVY VTGGKSL K  ELL     + I+ +Y+I+ FA++  VLS  P+FNSI  VSL AA+MS  YS IA  AS+ KG +   + YG +  T A  VF+ F+ +G +AFA+AGH+VVLEIQATIPSTPE PSK PMW+GVVVAYI+V +CY  VA+ GYW FG
Sbjct:   74 IIMSWAITFYSLWQMVQLHEAVPGKRLDRYPELGQEAFGPKLGYWIVMPQQLLVQIASDIVYNVTGGKSLKKFVELLFPN-LEHIRQTYYILGFAALQLVLSQSPDFNSIKIVSLLAALMSFLYSMIASVASIAKGTEHRPSTYGVRGDTVASMVFDAFNGIGTIAFAFAGHSVVLEIQATIPSTPEVPSKKPMWKGVVVAYIIVIICYLFVAISGYWAFG 293          
BLAST of FC931083 vs. ExPASy Swiss-Prot
Match: LHTL8_ARATH (Lysine histidine transporter-like 8 OS=Arabidopsis thaliana GN=AATL1 PE=1 SV=1)

HSP 1 Score: 190.66 bits (483), Expect = 7.246e-48
Identity = 91/224 (40.62%), Postives = 148/224 (66.07%), Query Frame = 1
Query:    1 LILSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLYIVVPQQLIVEVGVCIVYMVTGGKSLHKVHELLCKEPCKEIKLSY--FIMIFASVHFVLSHLPNFNSIAGVSLAAAVMSLSYSTIAWSASVRKGVQPDVAYG-YKAKTAAGTVFNFFSALGDVAFAYAGHNVVLEIQATIPSTPEKPSKGPMWRGVVVAYIVVALCYFPVALIGYWMFGN 663
            L +++   LYTLW +V++HE VPGKR++RY EL Q AFGE+LG+++ +   + +  G     ++ GG+++    +++C   C    L+   + ++F S+  VLS LPN NSIAG+SL  AV +++YST+ W  SV +     ++Y      + +G++F   +ALG +AFA+ GHN+VLEIQ+T+PST + P+  PMWRG  ++Y ++ALC FP+++ G+W +GN
Sbjct:  133 LTIAYCWQLYTLWILVQLHEAVPGKRYNRYVELAQAAFGERLGVWLALFPTVYLSAGTATALILIGGETMKLFFQIVCGPLCTSNPLTTVEWYLVFTSLCIVLSQLPNLNSIAGLSLIGAVTAITYSTMVWVLSVSQPRPATISYEPLSMPSTSGSLFAVLNALGIIAFAFRGHNLVLEIQSTMPSTFKHPAHVPMWRGAKISYFLIALCIFPISIGGFWAYGN 356          
BLAST of FC931083 vs. ExPASy Swiss-Prot
Match: LHTL7_ARATH (Lysine histidine transporter-like 7 OS=Arabidopsis thaliana GN=At4g35180 PE=2 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 6.149e-39
Identity = 81/238 (34.03%), Postives = 137/238 (57.56%), Query Frame = 1
Query:    1 LILSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLYIVVPQQLIVEVGVCIVYMVTGGKSLHKVHELLCKEPCKEIKLSYFIMIFASVHFVLSHLPNFNSIAGVSLAAAVMSLSYSTIAW---SASVRKGVQPDVAYGYKAKTAAGTVFNFFSALGDVAFAYAGHNVVLEIQATIPSTPEKPSKGPMWRGVVVAYIVVALCYFPVALIGYWMFGNKLKITSSFPLENHM 705
            L + ++  LYT W +V++HE VPG R  RY  L   +FG KLG  + +   + +  G C + ++TGGKS+ ++ +++  +    +      ++F+ +  ++S  PN NS+ GVSL  A M ++Y T+ W    AS  +  Q  V+Y     T   +  + F+A+G +A  Y G+N+VLEIQ T+PS  + PS   MWR V++++ +VA+C FP+    YW +G+K+  T   P+ N++
Sbjct:   75 LTVGFVWKLYTTWLLVQLHEAVPGIRISRYVRLAIASFGVKLGKLLGIFPVMYLSGGACTILVITGGKSIQQLLQIMSDDNTAPLTSVQCFLVFSCIAMIMSQFPNLNSLFGVSLIGAFMGIAYCTVIWILPVASDSQRTQVSVSYA----TMDKSFVHIFNAIGLIALVYRGNNLVLEIQGTLPSDSKNPSCKTMWRAVMISHALVAICMFPLTFAVYWAYGDKIPATGG-PVGNYL 307          
The following BLAST results are available for this feature:
BLAST of FC931083 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 18
Match NameE-valueIdentityDescription
LHT1_ARATH2.712e-11389.14Lysine histidine transporter 1 OS=Arabidopsis thal... [more]
LHTL1_ARATH4.621e-10375.61Lysine histidine transporter-like 1 OS=Arabidopsis... [more]
LHT2_ARATH1.259e-10073.98Lysine histidine transporter 2 OS=Arabidopsis thal... [more]
LHTL2_ARATH8.157e-10078.48Lysine histidine transporter-like 2 OS=Arabidopsis... [more]
LHTL3_ARATH9.355e-8868.89Lysine histidine transporter-like 3 OS=Arabidopsis... [more]
LHTL4_ARATH7.412e-8568.72Lysine histidine transporter-like 4 OS=Arabidopsis... [more]
LHTL6_ARATH2.162e-7662.73Lysine histidine transporter-like 6 OS=Arabidopsis... [more]
LHTL5_ARATH3.129e-6759.28Lysine histidine transporter-like 5 OS=Arabidopsis... [more]
LHTL8_ARATH7.246e-4840.63Lysine histidine transporter-like 8 OS=Arabidopsis... [more]
LHTL7_ARATH6.149e-3934.03Lysine histidine transporter-like 7 OS=Arabidopsis... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101C03EF PostHarvP1 Citrus clementina cDNA clone C34101C03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931083 ID=FC931083|Name=FC931083|organism=Citrus clementina|type=EST|length=739bp
CTGATATTGTCGTGGATCATCACTCTGTACACCTTGTGGCAAATGGTTGA
GATGCACGAGATGGTGCCGGGAAAACGGTTTGACAGATACCATGAACTGG
GGCAGCATGCTTTTGGTGAAAAACTTGGTCTCTATATCGTGGTGCCACAA
CAGCTTATTGTTGAAGTCGGTGTGTGCATTGTCTATATGGTTACGGGAGG
CAAATCACTGCATAAGGTCCATGAACTTTTATGCAAAGAACCATGCAAAG
AAATAAAACTTAGTTACTTCATCATGATCTTTGCCTCTGTTCACTTTGTA
CTCTCCCATCTCCCCAACTTCAATTCCATTGCCGGTGTCTCTTTGGCAGC
TGCAGTTATGTCCTTGAGTTACTCTACAATTGCTTGGTCAGCTTCAGTCC
GCAAGGGTGTTCAGCCAGATGTGGCGTATGGATACAAAGCTAAGACTGCA
GCAGGGACAGTCTTTAACTTCTTTAGTGCCTTGGGTGATGTGGCTTTTGC
ATATGCCGGGCACAATGTTGTCTTGGAGATCCAAGCAACAATCCCATCTA
CACCCGAGAAGCCATCCAAGGGGCCTATGTGGAGAGGAGTTGTTGTTGCC
TATATAGTCGTTGCATTGTGCTACTTCCCTGTTGCACTCATTGGATATTG
GATGTTTGGCAATAAGTTGAAGATAACATCCTCCTTTCCTTTGGAAAACC
ACATGGCTTATTGTATGGCTAACTTTCTTTGTGTGTCAT
back to top