FC931086

Overview
NameFC931086
Unique NameFC931086
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length733
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15313 contig Ccv1_Contig15313:26..759. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931086 vs. ExPASy Swiss-Prot
Match: HSP81_ORYSJ (Heat shock protein 81-1 OS=Oryza sativa subsp. japonica GN=HSP81-1 PE=2 SV=2)

HSP 1 Score: 382.489 bits (981), Expect = 1.280e-105
Identity = 193/218 (88.53%), Postives = 198/218 (90.83%), Query Frame = 2
Query:    2 SFSKNLNLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDK 655
            +FSKNL LGIHEDSTN+ K+AELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKK KE LKEKFEGLCKVIK+VLG               PCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSKKTMEINPEN IMEELRKRADADKNDK
Sbjct:  413 AFSKNLKLGIHEDSTNRNKIAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKRKEELKEKFEGLCKVIKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENAIMEELRKRADADKNDK 630          
BLAST of FC931086 vs. ExPASy Swiss-Prot
Match: HSP81_ORYSI (Heat shock protein 81-1 OS=Oryza sativa subsp. indica GN=HSP81-1 PE=2 SV=1)

HSP 1 Score: 382.489 bits (981), Expect = 1.280e-105
Identity = 193/218 (88.53%), Postives = 198/218 (90.83%), Query Frame = 2
Query:    2 SFSKNLNLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDK 655
            +FSKNL LGIHEDSTN+ K+AELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKK KE LKEKFEGLCKVIK+VLG               PCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSKKTMEINPEN IMEELRKRADADKNDK
Sbjct:  413 AFSKNLKLGIHEDSTNRNKIAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKRKEELKEKFEGLCKVIKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENAIMEELRKRADADKNDK 630          
BLAST of FC931086 vs. ExPASy Swiss-Prot
Match: HSP83_ORYSJ (Heat shock protein 81-3 OS=Oryza sativa subsp. japonica GN=HSP81-3 PE=2 SV=2)

HSP 1 Score: 378.252 bits (970), Expect = 2.413e-104
Identity = 190/218 (87.16%), Postives = 199/218 (91.28%), Query Frame = 2
Query:    2 SFSKNLNLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDK 655
            +FSKNL LGIHEDSTN+TK+AELLRYHSTKSGDELTSLKDYVTRMKEGQ++IYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKK +E LKEKFEGLCKVIK+VLG               PCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSKKTMEINPEN IM+ELRKRADADKNDK
Sbjct:  413 AFSKNLKLGIHEDSTNRTKIAELLRYHSTKSGDELTSLKDYVTRMKEGQSEIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKRQEELKEKFEGLCKVIKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENAIMDELRKRADADKNDK 630          
BLAST of FC931086 vs. ExPASy Swiss-Prot
Match: HSP82_ORYSJ (Heat shock protein 81-2 OS=Oryza sativa subsp. japonica GN=HSP81-2 PE=2 SV=1)

HSP 1 Score: 378.252 bits (970), Expect = 2.413e-104
Identity = 190/218 (87.16%), Postives = 199/218 (91.28%), Query Frame = 2
Query:    2 SFSKNLNLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDK 655
            +FSKNL LGIHEDSTN+TK+AELLRYHSTKSGDELTSLKDYVTRMKEGQ++IYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKK +E LKEKFEGLCKVIK+VLG               PCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSKKTMEINPEN IM+ELRKRADADKNDK
Sbjct:  413 AFSKNLKLGIHEDSTNRTKIAELLRYHSTKSGDELTSLKDYVTRMKEGQSEIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKRQEELKEKFEGLCKVIKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENSIMDELRKRADADKNDK 630          
BLAST of FC931086 vs. ExPASy Swiss-Prot
Match: HSP82_ARATH (Heat shock protein 81-2 OS=Arabidopsis thaliana GN=HSP81-2 PE=1 SV=1)

HSP 1 Score: 376.326 bits (965), Expect = 9.171e-104
Identity = 189/218 (86.70%), Postives = 197/218 (90.37%), Query Frame = 2
Query:    2 SFSKNLNLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDK 655
            +FSKNL LGIHEDS N+TK+AELLRYHSTKSGDELTSLKDYVTRMKEGQNDI+YITGESKKAVENSPFLEKLKKKG EVLYMVDAIDEYA+GQLKEFEGKKLVSATKEGLKLDE+EDEKK KE LKEKFEGLCKVIKDVLG               PCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSKKTMEINPEN IM+ELRKRADADKNDK
Sbjct:  411 AFSKNLKLGIHEDSQNRTKIAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIFYITGESKKAVENSPFLEKLKKKGIEVLYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLDETEDEKKKKEELKEKFEGLCKVIKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENSIMDELRKRADADKNDK 628          
BLAST of FC931086 vs. ExPASy Swiss-Prot
Match: HSP83_ARATH (Heat shock protein 81-3 OS=Arabidopsis thaliana GN=HSP81-3 PE=2 SV=2)

HSP 1 Score: 374.785 bits (961), Expect = 2.668e-103
Identity = 188/218 (86.24%), Postives = 196/218 (89.91%), Query Frame = 2
Query:    2 SFSKNLNLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDK 655
            +FSKNL LGIHEDS N+TK+AELLRYHSTKSGDELTSLKDYVTRMKEGQNDI+YITGESKKAVENSPFLEKLKKKG EVLYMVDAIDEYA+GQLKEFEGKKLVSATKEGLKLDE+EDEKK KE LKEKFEGLCKVIKDVLG               PCCLVTGEYGWTANMERIMKAQALRD+SM GYMSSKKTMEINPEN IM+ELRKRADADKNDK
Sbjct:  411 AFSKNLKLGIHEDSQNRTKIAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIFYITGESKKAVENSPFLEKLKKKGIEVLYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLDETEDEKKKKEELKEKFEGLCKVIKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKTMEINPENSIMDELRKRADADKNDK 628          
BLAST of FC931086 vs. ExPASy Swiss-Prot
Match: HSP80_SOLLC (Heat shock cognate protein 80 OS=Solanum lycopersicum GN=HSC80 PE=2 SV=1)

HSP 1 Score: 374.785 bits (961), Expect = 2.668e-103
Identity = 187/218 (85.78%), Postives = 196/218 (89.91%), Query Frame = 2
Query:    2 SFSKNLNLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDK 655
            +FSKNL LGIHEDS N+ K AELLRYHSTKSGDE+TSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEY++GQLKEFEGKKLVSATKEGLKLDESEDEKK +E LKEKFEGLCKV+KDVLG               PCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSKKTMEINPEN IM+ELRKRADADKNDK
Sbjct:  411 AFSKNLKLGIHEDSQNRAKFAELLRYHSTKSGDEMTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYSIGQLKEFEGKKLVSATKEGLKLDESEDEKKKQEELKEKFEGLCKVMKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENSIMDELRKRADADKNDK 628          
BLAST of FC931086 vs. ExPASy Swiss-Prot
Match: HSP82_TOBAC (Heat shock protein 82 (Fragment) OS=Nicotiana tabacum GN=HSP82 PE=2 SV=1)

HSP 1 Score: 352.058 bits (902), Expect = 1.852e-96
Identity = 176/219 (80.37%), Postives = 192/219 (87.67%), Query Frame = 2
Query:    2 SFSKNLNLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKL-DESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDK 655
            +FSKNL LGIHEDS N+ KLA+LLRYHSTKSGDE+TSLKDYVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKGYEVLYMVDAIDEYAVGQLKE++GKKLVSATKEGLKL D+SE+EKK KE  K+ FE LCK+IKD+LG               PCCLVTGEYGWTANMERIMKAQALRD+SM+ YMSSKKTMEINP+N IMEELRKRA+ADKNDK
Sbjct:  212 AFSKNLKLGIHEDSQNRAKLADLLRYHSTKSGDEMTSLKDYVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLYMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLDDDSEEEKKKKEEKKKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDK 430          
BLAST of FC931086 vs. ExPASy Swiss-Prot
Match: HSP83_IPONI (Heat shock protein 83 OS=Ipomoea nil GN=HSP83A PE=2 SV=1)

HSP 1 Score: 346.28 bits (887), Expect = 1.016e-94
Identity = 173/219 (79.00%), Postives = 191/219 (87.21%), Query Frame = 2
Query:    2 SFSKNLNLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKL-DESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDK 655
            +FSKNL LGIHEDS N+ KLA+LLRY+STKSGDELTSLKDYVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEYAVGQLKE++GKKLVSATKEGLKL D+ E+EKK +E  K+ FE LCK+IKD+LG               PCCLVTGEYGWTANMERIMKAQALRD+SM+ YMSSKKTMEINP+N IMEELRKRA+ADKNDK
Sbjct:  416 AFSKNLKLGIHEDSQNRAKLADLLRYYSTKSGDELTSLKDYVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLEDDDEEEKKKREEKKKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDK 634          
BLAST of FC931086 vs. ExPASy Swiss-Prot
Match: HSP81_ARATH (Heat shock protein 81-1 OS=Arabidopsis thaliana GN=HSP81-1 PE=1 SV=3)

HSP 1 Score: 344.739 bits (883), Expect = 2.957e-94
Identity = 171/219 (78.08%), Postives = 191/219 (87.21%), Query Frame = 2
Query:    2 SFSKNLNLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKL-DESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDK 655
            +FSKNL LGIHEDS N+ K+A+LLRYHSTKSGDE+TS KDYVTRMKEGQ DI+YITGESKKAVENSPFLE+LKK+GYEVLYMVDAIDEYAVGQLKE++GKKLVSATKEGLKL DE+E+EKK +E  K+ FE LCK IK++LG               PCCLVTGEYGWTANMERIMKAQALRD+SM+GYMSSKKTMEINP+N IMEELRKRA+ADKNDK
Sbjct:  412 AFSKNLKLGIHEDSQNRGKIADLLRYHSTKSGDEMTSFKDYVTRMKEGQKDIFYITGESKKAVENSPFLERLKKRGYEVLYMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLEDETEEEKKKREEKKKSFENLCKTIKEILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSKKTMEINPDNGIMEELRKRAEADKNDK 630          
The following BLAST results are available for this feature:
BLAST of FC931086 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 374
Match NameE-valueIdentityDescription
HSP81_ORYSJ1.280e-10588.53Heat shock protein 81-1 OS=Oryza sativa subsp. jap... [more]
HSP81_ORYSI1.280e-10588.53Heat shock protein 81-1 OS=Oryza sativa subsp. ind... [more]
HSP83_ORYSJ2.413e-10487.16Heat shock protein 81-3 OS=Oryza sativa subsp. jap... [more]
HSP82_ORYSJ2.413e-10487.16Heat shock protein 81-2 OS=Oryza sativa subsp. jap... [more]
HSP82_ARATH9.171e-10486.70Heat shock protein 81-2 OS=Arabidopsis thaliana GN... [more]
HSP83_ARATH2.668e-10386.24Heat shock protein 81-3 OS=Arabidopsis thaliana GN... [more]
HSP80_SOLLC2.668e-10385.78Heat shock cognate protein 80 OS=Solanum lycopersi... [more]
HSP82_TOBAC1.852e-9680.37Heat shock protein 82 (Fragment) OS=Nicotiana taba... [more]
HSP83_IPONI1.016e-9479.00Heat shock protein 83 OS=Ipomoea nil GN=HSP83A PE=... [more]
HSP81_ARATH2.957e-9478.08Heat shock protein 81-1 OS=Arabidopsis thaliana GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101C07EF PostHarvP1 Citrus clementina cDNA clone C34101C07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931086 ID=FC931086|Name=FC931086|organism=Citrus clementina|type=EST|length=733bp
GTCATTCTCTAAGAACCTAAATCTTGGTATCCACGAGGACTCCACCAACA
AGACCAAGCTTGCTGAGCTGCTCCGATACCATTCCACCAAGAGTGGTGAT
GAGTTGACTAGCTTGAAGGACTATGTGACCAGAATGAAGGAAGGCCAGAA
TGATATCTACTACATCACTGGTGAGAGCAAGAAGGCTGTTGAGAACTCCC
CATTTCTTGAGAAGCTCAAGAAGAAGGGCTATGAAGTGCTCTACATGGTT
GATGCCATAGATGAGTACGCTGTTGGTCAGCTCAAGGAGTTTGAGGGAAA
GAAGCTTGTCTCAGCGACCAAAGAAGGTCTCAAGCTTGATGAGAGTGAAG
ATGAGAAGAAGATGAAGGAAACCTTGAAGGAGAAATTTGAGGGTCTCTGC
AAGGTGATCAAGGATGTTTTGGGTGACAAGGTCGAGAAGGTTGTGGTGTC
TGACCGTGTTGTTGACTCACCCTGCTGTTTGGTGACTGGTGAGTATGGAT
GGACAGCCAACATGGAGAGGATCATGAAGGCTCAGGCCTTGAGAGACAAC
AGCATGGCTGGTTACATGTCCAGCAAGAAGACCATGGAGATCAATCCGGA
GAACCCCATCATGGAGGAGCTCAGGAAGAGGGCTGATGCGGACAAGAATG
ACAAGTCTGTGAAGGACCTTGTCCTTCTGCTCTTTGAACTGCTCTCCTCA
CTTCTGGTTNCAGCCTTGATGACCCTACACTTT
back to top