FC931092

Overview
NameFC931092
Unique NameFC931092
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length668
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC931092_ssr36 microsatellite FC931092_ssr36:36..47. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig15281 contig Ccv1_Contig15281:5..672. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931092 vs. ExPASy Swiss-Prot
Match: DFRA_MALDO (Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase OS=Malus domestica GN=DFR PE=1 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 4.601e-48
Identity = 98/201 (48.76%), Postives = 137/201 (68.16%), Query Frame = 1
Query:   58 VCVTGASGYIASWLVKLLLSRGYTVKASVRDPNDPKKTRHLLALDGASERLQLFKANLLEEGSFDSIVDGCDGVCHTASPFYHDAKDPQVELLDPAVKGTLNVLNSCAKFPSIKRVVLTSSMAAVLNTGKPRTPDVVVDETWFSDPEVCKQSEL--W-YPLSKALAEDAAWKFAKEKSIDLVTINPAMVIGPLLQPTLNTS 651
            VCVTGASG+I SWLV  LL  GYTV+A+VRDP + KK +HLL L  A   L L+KA+L +EGSFD  + GC GV H A+P   ++KDP+ E++ P + G L++L +C K  +++++V TSS A  +N  + + P  V DE+ +SD E C+  ++  W Y +SK LAE AAWK+AKE +ID +TI P +VIGP L P++  S
Sbjct:    8 VCVTGASGFIGSWLVMRLLEHGYTVRATVRDPTNQKKVKHLLDLPKAETHLTLWKADLADEGSFDEAIQGCSGVFHVATPMDFESKDPENEVIKPTINGLLDILKACQKAKTVRKLVFTSS-AGTVNVEEHQKP--VYDESNWSDVEFCRSVKMTGWMYFVSKTLAEQAAWKYAKENNIDFITIIPTLVIGPFLMPSMPPS 205          
BLAST of FC931092 vs. ExPASy Swiss-Prot
Match: DFRA_PYRCO (Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase OS=Pyrus communis GN=DFR PE=1 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 1.025e-47
Identity = 97/201 (48.26%), Postives = 137/201 (68.16%), Query Frame = 1
Query:   58 VCVTGASGYIASWLVKLLLSRGYTVKASVRDPNDPKKTRHLLALDGASERLQLFKANLLEEGSFDSIVDGCDGVCHTASPFYHDAKDPQVELLDPAVKGTLNVLNSCAKFPSIKRVVLTSSMAAVLNTGKPRTPDVVVDETWFSDPEVCKQSEL--W-YPLSKALAEDAAWKFAKEKSIDLVTINPAMVIGPLLQPTLNTS 651
            VCVTGASG+I SWLV  LL  GYTV+A+VRDP + KK +HLL L  A   L L+KA+L +EGSFD  + GC GV H A+P   +++DP+ E++ P + G L++L +C K  +++++V TSS A  +N  + + P  V DE+ +SD E C+  ++  W Y +SK LAE AAWK+AKE +ID +TI P +VIGP L P++  S
Sbjct:    8 VCVTGASGFIGSWLVMRLLEHGYTVRATVRDPTNQKKVKHLLDLPKAETHLTLWKADLADEGSFDEAIQGCSGVFHVATPMDFESRDPENEVIKPTINGLLDILKACQKAKTVRKLVFTSS-AGTVNVEEHQKP--VYDESNWSDVEFCRSVKMTGWMYFVSKTLAEQAAWKYAKENNIDFITIIPTLVIGPFLMPSMPPS 205          
BLAST of FC931092 vs. ExPASy Swiss-Prot
Match: DFRA_VITVI (Dihydroflavonol-4-reductase OS=Vitis vinifera GN=DFR PE=1 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 7.345e-46
Identity = 95/203 (46.80%), Postives = 136/203 (67.00%), Query Frame = 1
Query:   52 KVVCVTGASGYIASWLVKLLLSRGYTVKASVRDPNDPKKTRHLLALDGASERLQLFKANLLEEGSFDSIVDGCDGVCHTASPFYHDAKDPQVELLDPAVKGTLNVLNSCAKFPSIKRVVLTSSMAAVLNTGKPRTPDVVVDETWFSDPEVCKQSEL--W-YPLSKALAEDAAWKFAKEKSIDLVTINPAMVIGPLLQPTLNTS 651
            + VCVTGASG+I SWLV  LL R  TV+A+VRDP + KK +HLL L  A   L L+KA+L +EGSFD  + GC GV H A+P   ++KDP+ E++ P ++G L ++ SCA   +++R+V TSS A  +N  + + P  V DE+ +SD E C+  ++  W Y +SK LAE AAWK+AKE +ID +TI P +V+GP +  ++  S
Sbjct:    6 ETVCVTGASGFIGSWLVMRLLERRLTVRATVRDPTNVKKVKHLLDLPKAETHLTLWKADLADEGSFDEAIKGCTGVFHVATPMDFESKDPENEVIKPTIEGMLGIMKSCAAAKTVRRLVFTSS-AGTVNIQEHQLP--VYDESCWSDMEFCRAKKMTAWMYFVSKTLAEQAAWKYAKENNIDFITIIPTLVVGPFIMSSMPPS 205          
BLAST of FC931092 vs. ExPASy Swiss-Prot
Match: DFRA_DIACA (Dihydroflavonol-4-reductase OS=Dianthus caryophyllus GN=A PE=2 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 2.137e-45
Identity = 96/204 (47.06%), Postives = 137/204 (67.16%), Query Frame = 1
Query:   49 GKVVCVTGASGYIASWLVKLLLSRGYTVKASVRDPNDPKKTRHLLALDGASERLQLFKANLLEEGSFDSIVDGCDGVCHTASPFYHDAKDPQVELLDPAVKGTLNVLNSCAKFPSIKRVVLTSSMAAVLNTGKPRTPDVVVDETWFSDPEVCKQSEL--W-YPLSKALAEDAAWKFAKEKSIDLVTINPAMVIGPLLQPTLNTS 651
            G+ VCVTGASG+I SWL+  LL RGYTV+A+VRDP++ KK +HLL L  A   L L+KA+L EEGSFD+ VDGC GV H A+P   ++KDP+ E++ P + G L++L SC K   ++RVV TSS    +N    + P  V DET +S  +  +  ++  W Y +SK LAE AAWK+A E +++ ++I P +V+GP + P++  S
Sbjct:   22 GETVCVTGASGFIGSWLIMRLLERGYTVRATVRDPDNTKKVQHLLDLPNAKTNLTLWKADLHEEGSFDAAVDGCTGVFHIATPMDFESKDPENEMIKPTINGMLDILKSCVK-AKLRRVVFTSS-GGTVNVEATQKP--VYDETCWSALDFIRSVKMTGWMYFVSKILAEQAAWKYAAENNLEFISIIPPLVVGPFIMPSMPPS 221          
BLAST of FC931092 vs. ExPASy Swiss-Prot
Match: DFRA_CALCH (Dihydroflavonol-4-reductase OS=Callistephus chinensis GN=F PE=2 SV=1)

HSP 1 Score: 179.104 bits (453), Expect = 1.809e-44
Identity = 95/201 (47.26%), Postives = 135/201 (67.16%), Query Frame = 1
Query:   58 VCVTGASGYIASWLVKLLLSRGYTVKASVRDPNDPKKTRHLLALDGASERLQLFKANLLEEGSFDSIVDGCDGVCHTASPFYHDAKDPQVELLDPAVKGTLNVLNSCAKFPSIKRVVLTSSMAAVLNTGKPRTPDVVVDETWFSDPE--VCKQSELW-YPLSKALAEDAAWKFAKEKSIDLVTINPAMVIGPLLQPTLNTS 651
            VCVTGA+G+I SWLV  LL RGY V+A+VR+P D KK +HLL L  A   L L+KA+L +EGSFD  ++GC GV H A+P   ++KDP+ E++ P ++G L+++ SCAK  ++K++V TSS A  +N  + + P  V DE+ +SD +    K+   W Y +SK LAE AA + AKE +ID V+I P +V+GP + PT   S
Sbjct:    9 VCVTGAAGFIGSWLVMRLLERGYIVRATVRNPGDMKKVKHLLELPKAETNLTLWKADLTQEGSFDEAIEGCHGVFHVATPMDFESKDPENEIIKPTIEGILSIIRSCAKAKTVKKLVYTSS-AGTVNVQETQLP--VYDESHWSDLDFIYSKKMTAWMYFVSKTLAEKAAMEAAKENNIDFVSIIPPLVVGPFINPTFPPS 206          
BLAST of FC931092 vs. ExPASy Swiss-Prot
Match: DFRA_ARATH (Dihydroflavonol-4-reductase OS=Arabidopsis thaliana GN=DFRA PE=2 SV=2)

HSP 1 Score: 174.866 bits (442), Expect = 3.412e-43
Identity = 94/203 (46.31%), Postives = 133/203 (65.52%), Query Frame = 1
Query:   52 KVVCVTGASGYIASWLVKLLLSRGYTVKASVRDPNDPKKTRHLLALDGASERLQLFKANLLEEGSFDSIVDGCDGVCHTASPFYHDAKDPQVELLDPAVKGTLNVLNSCAKFPSIKRVVLTSSMAAVLNTGKPRTPDVVVDETWFSDPE--VCKQSELW-YPLSKALAEDAAWKFAKEKSIDLVTINPAMVIGPLLQPTLNTS 651
            + VCVTGASG+I SWLV  LL RGY V+A+VRDP + KK +HLL L  A   L L+KA+L EEGS+D  ++GCDGV H A+P   ++KDP+ E++ P V G L ++ +C K  +++R V TSS A  +N  + +    V DE  +SD E  + K+   W Y +SK LAE AAW FA+EK +D ++I P +V+GP +  ++  S
Sbjct:    6 ETVCVTGASGFIGSWLVMRLLERGYFVRATVRDPGNLKKVQHLLDLPNAKTLLTLWKADLSEEGSYDDAINGCDGVFHVATPMDFESKDPENEVIKPTVNGMLGIMKACVKAKTVRRFVFTSS-AGTVNVEEHQKN--VYDENDWSDLEFIMSKKMTGWMYFVSKTLAEKAAWDFAEEKGLDFISIIPTLVVGPFITTSMPPS 205          
BLAST of FC931092 vs. ExPASy Swiss-Prot
Match: DFRA_PETHY (Dihydroflavonol-4-reductase OS=Petunia hybrida GN=DFRA PE=2 SV=2)

HSP 1 Score: 170.629 bits (431), Expect = 6.435e-42
Identity = 93/201 (46.27%), Postives = 130/201 (64.68%), Query Frame = 1
Query:   58 VCVTGASGYIASWLVKLLLSRGYTVKASVRDPNDPKKTRHLLALDGASERLQLFKANLLEEGSFDSIVDGCDGVCHTASPFYHDAKDPQVELLDPAVKGTLNVLNSCAKFPSIKRVVLTSSMAAVLNTGKPRTPDVVVDETWFSDPEVC---KQSELWYPLSKALAEDAAWKFAKEKSIDLVTINPAMVIGPLLQPTLNTS 651
            VCVTGA+G+I SWLV  LL RGY V A+VRDP + KK +HLL L  A   L L+KA+L  EGSFD  + GC GV H A+P   ++KDP+ E++ P V+G L+++ SCAK  ++KR+V TSS A  L+  + +   +  D+T +SD +     K +   Y  SK LAE AA + AK+K+ID ++I P +V+GP + PT   S
Sbjct:   18 VCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELPKADTNLTLWKADLTVEGSFDEAIQGCQGVFHVATPMDFESKDPENEVIKPTVRGMLSIIESCAKANTVKRLVFTSS-AGTLDVQEQQ--KLFYDQTSWSDLDFIYAKKMTGWMYFASKILAEKAAMEEAKKKNIDFISIIPPLVVGPFITPTFPPS 215          
BLAST of FC931092 vs. ExPASy Swiss-Prot
Match: DFRA_ANTMA (Dihydroflavonol-4-reductase OS=Antirrhinum majus GN=DFRA PE=2 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 1.098e-41
Identity = 90/213 (42.25%), Postives = 131/213 (61.50%), Query Frame = 1
Query:   22 TMSSVAAAAGKVVCVTGASGYIASWLVKLLLSRGYTVKASVRDPNDPKKTRHLLALDGASERLQLFKANLLEEGSFDSIVDGCDGVCHTASPFYHDAKDPQVELLDPAVKGTLNVLNSCAKFPSIKRVVLTSSMAAVLNTGKPRTPDVVVDETWFSDPEVCKQSEL--W-YPLSKALAEDAAWKFAKEKSIDLVTINPAMVIGPLLQPTLNTS 651
            T S  A  +   VCVTGA+G+I SWLV  LL RGYTV+A+VRDP + KK +HL+ L  A   L L+KA++  EGSFD  + GC+GV H A+    D+ DP+ E++ P + G LN++ SC +  ++K+ + T+S    +N  + + P  V DET  SD +     ++  W Y +SK LAE A  + AKE +ID ++I P +V+GP + PT   S
Sbjct:    8 TSSETAPPSSTTVCVTGAAGFIGSWLVMRLLERGYTVRATVRDPGNMKKVKHLIELPKADTNLTLWKADMTVEGSFDEAIQGCEGVFHLATSMEFDSVDPENEVIKPTIDGMLNIIKSCVQAKTVKKFIFTTS-GGTVNVEEHQKP--VYDETDSSDMDFINSKKMTGWMYFVSKILAEKAGMEAAKENNIDFISIIPPLVVGPFIMPTFPPS 217          
BLAST of FC931092 vs. ExPASy Swiss-Prot
Match: DFRA_HORVU (Dihydroflavonol-4-reductase OS=Hordeum vulgare GN=ANT18 PE=3 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 1.434e-41
Identity = 87/194 (44.85%), Postives = 132/194 (68.04%), Query Frame = 1
Query:   58 VCVTGASGYIASWLVKLLLSRGYTVKASVRDPNDPKKTRHLLALDGASERLQLFKANLLEEGSFDSIVDGCDGVCHTASPFYHDAKDPQVELLDPAVKGTLNVLNSCAKFPSIKRVVLTSSMAAVLNTGKPRTPDVVVDETWFSDPEVCKQSEL--W-YPLSKALAEDAAWKFAKEKSIDLVTINPAMVIGPLL 630
            V VTGASG++ SWLV  LL  GYTV+A+VRDP + +KT+ LL L GA ERL ++KA+L E+GSF+  + GC GV H A+P   D++DP+ E++ P V+G L+++ +C +  ++KR+V TSS  +V    +PR      D+  +SD + C++ ++  W Y +SKALAE AA ++A E  +D ++I P +V+GP L
Sbjct:    8 VVVTGASGFVGSWLVMKLLQAGYTVRATVRDPANVEKTKPLLELPGAKERLSIWKADLSEDGSFNEAIAGCTGVFHVATPMDFDSQDPENEVIKPTVEGMLSIMRACKEAGTVKRIVFTSSAGSVNIEERPRP---AYDQDNWSDIDYCRRVKMTGWMYFVSKALAEKAAMEYASENGLDFISIIPTLVVGPFL 198          
BLAST of FC931092 vs. ExPASy Swiss-Prot
Match: DFRA_GERHY (Dihydroflavonol-4-reductase OS=Gerbera hybrida GN=DFR PE=2 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 1.434e-41
Identity = 90/201 (44.78%), Postives = 125/201 (62.19%), Query Frame = 1
Query:   58 VCVTGASGYIASWLVKLLLSRGYTVKASVRDPNDPKKTRHLLALDGASERLQLFKANLLEEGSFDSIVDGCDGVCHTASPFYHDAKDPQVELLDPAVKGTLNVLNSCAKFPSIKRVVLTSSMAAVLNTGKPRTPDVVVDETWFSDPE--VCKQSELW-YPLSKALAEDAAWKFAKEKSIDLVTINPAMVIGPLLQPTLNTS 651
            VCVTGA+G+I SWLV  LL RGY V A+VRDP D KK +HLL L  A   L+L+KA+L +EGSFD  + GC GV H A+P   ++KDP+ E++ P ++G L+++ SC K  ++K++V TSS   V    K      V DE+ +SD +    K+   W Y +SK LAE AAW   K  +I  ++I P +V+GP +  T   S
Sbjct:    9 VCVTGAAGFIGSWLVMRLLERGYVVHATVRDPGDLKKVKHLLELPKAQTNLKLWKADLTQEGSFDEAIQGCHGVFHLATPMDFESKDPENEIIKPTIEGVLSIIRSCVKAKTVKKLVFTSSAGTVNGQEKQLH---VYDESHWSDLDFIYSKKMTAWMYFVSKTLAEKAAWDATKGNNISFISIIPTLVVGPFITSTFPPS 206          
The following BLAST results are available for this feature:
BLAST of FC931092 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 21
Match NameE-valueIdentityDescription
DFRA_MALDO4.601e-4848.76Bifunctional dihydroflavonol 4-reductase/flavanone... [more]
DFRA_PYRCO1.025e-4748.26Bifunctional dihydroflavonol 4-reductase/flavanone... [more]
DFRA_VITVI7.345e-4646.80Dihydroflavonol-4-reductase OS=Vitis vinifera GN=D... [more]
DFRA_DIACA2.137e-4547.06Dihydroflavonol-4-reductase OS=Dianthus caryophyll... [more]
DFRA_CALCH1.809e-4447.26Dihydroflavonol-4-reductase OS=Callistephus chinen... [more]
DFRA_ARATH3.412e-4346.31Dihydroflavonol-4-reductase OS=Arabidopsis thalian... [more]
DFRA_PETHY6.435e-4246.27Dihydroflavonol-4-reductase OS=Petunia hybrida GN=... [more]
DFRA_ANTMA1.098e-4142.25Dihydroflavonol-4-reductase OS=Antirrhinum majus G... [more]
DFRA_HORVU1.434e-4144.85Dihydroflavonol-4-reductase OS=Hordeum vulgare GN=... [more]
DFRA_GERHY1.434e-4144.78Dihydroflavonol-4-reductase OS=Gerbera hybrida GN=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101D01EF PostHarvP1 Citrus clementina cDNA clone C34101D01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931092 ID=FC931092|Name=FC931092|organism=Citrus clementina|type=EST|length=668bp
GATTGCGAGAATCATTCGTTGACAATGAGCAGTGTAGCAGCAGCAGCGGG
GAAGGTCGTATGCGTGACCGGAGCATCGGGTTACATAGCTTCATGGCTTG
TCAAGCTTCTTCTTTCTCGTGGCTACACTGTCAAGGCCTCTGTTCGTGAT
CCCAATGATCCAAAAAAGACAAGACACTTACTTGCACTTGATGGAGCTTC
GGAAAGACTTCAGTTGTTTAAGGCAAATCTTTTGGAAGAAGGATCCTTTG
ATTCAATTGTTGATGGGTGCGATGGTGTTTGCCATACTGCATCTCCCTTT
TACCATGATGCCAAGGATCCGCAGGTGGAGTTACTTGATCCTGCTGTGAA
AGGAACTCTTAATGTTCTTAACTCATGTGCGAAGTTCCCTTCTATCAAAC
GAGTGGTTTTAACATCTTCAATGGCTGCAGTTTTAAACACTGGAAAACCT
CGAACCCCTGATGTGGTAGTTGATGAGACTTGGTTCTCGGATCCGGAGGT
TTGCAAGCAATCAGAGCTCTGGTATCCACTTTCAAAGGCATTGGCTGAGG
ATGCAGCTTGGAAATTTGCAAAGGAGAAGAGTATTGACTTGGTTACCATT
AACCCGGCAATGGTTATTGGTCCTCTCTTACAGCCAACACTTAACACAAG
TGCTGNCTGCAGTTCTAG
back to top