FC931093

Overview
NameFC931093
Unique NameFC931093
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length710
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15113 contig Ccv1_Contig15113:50..759. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931093 vs. ExPASy Swiss-Prot
Match: ATHB7_ARATH (Homeobox-leucine zipper protein ATHB-7 OS=Arabidopsis thaliana GN=ATHB-7 PE=2 SV=2)

HSP 1 Score: 179.104 bits (453), Expect = 2.042e-44
Identity = 102/182 (56.04%), Postives = 126/182 (69.23%), Query Frame = 2
Query:  137 MLDGGEYSPA---AEPYSCMNEIXXXXXXXXXXXXXXXXFSDEQIRSLELMFENETRLEPRKKLQLAKELGLQPRQVAIWFQNKRARWKSKQLERDYNILQANFNNLASRFEALKKEKQALVIQLQKTNELLQNKPRREDQSPSERQCCGQ--VEGVNSMESELDNGDRDTNKCESEVKPSL 667
            M +GGEYSPA   AEP+  M ++                FSDEQI+SLE+MFE+ETRLEPRKK+QLA+ELGLQPRQVAIWFQNKRARWKSKQLE +YNIL+ N++NLAS+FE+LKKEKQALV +LQ+  E  Q K + E     ERQC G   V  ++S   E +N +    K E EV+P +
Sbjct:    1 MTEGGEYSPAMMSAEPFLTMKKMKKSNHNKNNQRR----FSDEQIKSLEMMFESETRLEPRKKVQLARELGLQPRQVAIWFQNKRARWKSKQLETEYNILRQNYDNLASQFESLKKEKQALVSELQRLKEATQKKTQEE-----ERQCSGDQAVVALSSTHHESENEENRRRKPE-EVRPEM 172          
BLAST of FC931093 vs. ExPASy Swiss-Prot
Match: ATB12_ARATH (Homeobox-leucine zipper protein ATHB-12 OS=Arabidopsis thaliana GN=ATHB-12 PE=2 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 7.514e-39
Identity = 80/126 (63.49%), Postives = 102/126 (80.95%), Query Frame = 2
Query:  245 FSDEQIRSLELMFENETRLEPRKKLQLAKELGLQPRQVAIWFQNKRARWKSKQLERDYNILQANFNNLASRFEALKKEKQALVIQLQKTNELLQNKPRREDQSPSERQCCGQVEGVNSMESELDNG 622
            FS+EQI+SLEL+FE+ETRLEPRKK+Q+A+ELGLQPRQVAIWFQNKRARWK+KQLE++YN L+AN+NNLAS+FE +KKEKQ+LV +LQ+ NE +Q +P+ E       +CCG      S  +E  NG
Sbjct:   34 FSEEQIKSLELIFESETRLEPRKKVQVARELGLQPRQVAIWFQNKRARWKTKQLEKEYNTLRANYNNLASQFEIMKKEKQSLVSELQRLNEEMQ-RPKEE----KHHECCGDQGLALSSSTESHNG 154          
BLAST of FC931093 vs. ExPASy Swiss-Prot
Match: HOX6_ORYSJ (Homeobox-leucine zipper protein HOX6 OS=Oryza sativa subsp. japonica GN=HOX6 PE=2 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 4.416e-31
Identity = 68/120 (56.67%), Postives = 89/120 (74.17%), Query Frame = 2
Query:  245 FSDEQIRSLELMFENETRLEPRKKLQLAKELGLQPRQVAIWFQNKRARWKSKQLERDYNILQANFNNLASRFEALKKEKQALVIQLQKTNELLQNKPRREDQSPSERQCCGQVEGVNSME 604
            FS+EQI+SLE MF  +T+LEPR+KLQLA+ELGLQPRQVAIWFQNKRARWKSKQLER+Y+ L+ +++ L   +E+LKKEK AL+ QL+K  E+LQ    +   +  +    G V G+   E
Sbjct:   34 FSEEQIKSLESMFATQTKLEPRQKLQLARELGLQPRQVAIWFQNKRARWKSKQLEREYSALRDDYDALLCSYESLKKEKLALIKQLEKLAEMLQEPRGKYGDNAGDDARSGGVAGMKKEE 153          
BLAST of FC931093 vs. ExPASy Swiss-Prot
Match: HOX6_ORYSI (Homeobox-leucine zipper protein HOX6 OS=Oryza sativa subsp. indica GN=HOX6 PE=2 SV=2)

HSP 1 Score: 134.806 bits (338), Expect = 4.416e-31
Identity = 68/120 (56.67%), Postives = 89/120 (74.17%), Query Frame = 2
Query:  245 FSDEQIRSLELMFENETRLEPRKKLQLAKELGLQPRQVAIWFQNKRARWKSKQLERDYNILQANFNNLASRFEALKKEKQALVIQLQKTNELLQNKPRREDQSPSERQCCGQVEGVNSME 604
            FS+EQI+SLE MF  +T+LEPR+KLQLA+ELGLQPRQVAIWFQNKRARWKSKQLER+Y+ L+ +++ L   +E+LKKEK AL+ QL+K  E+LQ    +   +  +    G V G+   E
Sbjct:   34 FSEEQIKSLESMFATQTKLEPRQKLQLARELGLQPRQVAIWFQNKRARWKSKQLEREYSALRDDYDALLCSYESLKKEKLALIKQLEKLAEMLQEPRGKYGDNAGDDARSGGVAGMKKEE 153          
BLAST of FC931093 vs. ExPASy Swiss-Prot
Match: HOX22_ORYSJ (Homeobox-leucine zipper protein HOX22 OS=Oryza sativa subsp. japonica GN=HOX22 PE=2 SV=2)

HSP 1 Score: 123.635 bits (309), Expect = 1.018e-27
Identity = 65/132 (49.24%), Postives = 86/132 (65.15%), Query Frame = 2
Query:  245 FSDEQIRSLELMFE-NETRLEPRKKLQLAKELGLQPRQVAIWFQNKRARWKSKQLERDYNILQANFNNLASRFEALKKEKQALVIQLQKTNELLQNKPRREDQSPSERQCCGQVEGVNSMESELDNGDRDTN 637
            F++EQIRSLE MF  +  +LEPR+K +LA+ELGLQPRQVAIWFQNKRARW+SKQLE DY  L++ ++ L SR E+LK+EK AL +QL +  E L+ +  R     +            S   E+D+ D   N
Sbjct:   77 FTEEQIRSLESMFHAHHAKLEPREKAELARELGLQPRQVAIWFQNKRARWRSKQLEHDYAALRSKYDALHSRVESLKQEKLALTVQLHELRERLREREERSGNGGAATTAASSSSCNGSGSEEVDDDDDKRN 208          
BLAST of FC931093 vs. ExPASy Swiss-Prot
Match: HOX22_ORYSI (Homeobox-leucine zipper protein HOX22 OS=Oryza sativa subsp. indica GN=HOX22 PE=2 SV=2)

HSP 1 Score: 123.635 bits (309), Expect = 1.018e-27
Identity = 65/132 (49.24%), Postives = 86/132 (65.15%), Query Frame = 2
Query:  245 FSDEQIRSLELMFE-NETRLEPRKKLQLAKELGLQPRQVAIWFQNKRARWKSKQLERDYNILQANFNNLASRFEALKKEKQALVIQLQKTNELLQNKPRREDQSPSERQCCGQVEGVNSMESELDNGDRDTN 637
            F++EQIRSLE MF  +  +LEPR+K +LA+ELGLQPRQVAIWFQNKRARW+SKQLE DY  L++ ++ L SR E+LK+EK AL +QL +  E L+ +  R     +            S   E+D+ D   N
Sbjct:   77 FTEEQIRSLESMFHAHHAKLEPREKAELARELGLQPRQVAIWFQNKRARWRSKQLEHDYAALRSKYDALHSRVESLKQEKLALTVQLHELRERLREREERSGNGGAATTAASSSSCNGSGSEEVDDDDDKRN 208          
BLAST of FC931093 vs. ExPASy Swiss-Prot
Match: HOX24_ORYSI (Homeobox-leucine zipper protein HOX24 OS=Oryza sativa subsp. indica GN=HOX24 PE=2 SV=2)

HSP 1 Score: 112.464 bits (280), Expect = 2.347e-24
Identity = 59/106 (55.66%), Postives = 78/106 (73.58%), Query Frame = 2
Query:  245 FSDEQIRSLELMFE-NETRLEPRKKLQLAKELGLQPRQVAIWFQNKRARWKSKQLERDYNILQANFNNLASRFEALKKEKQALVIQLQKTNELLQNKPRREDQSPS 559
            F++EQ+RSLE  F     +LEPR+K +LA+ELGLQPRQVAIWFQNKRARW+SKQ+E DY  L+A ++ L +R E+L++EK AL  Q+   +EL      R+DQS S
Sbjct:   69 FTEEQVRSLETTFHARRAKLEPREKAELARELGLQPRQVAIWFQNKRARWRSKQIEHDYAALRAQYDALHARVESLRQEKLALAAQV---DELRGKLNERQDQSGS 171          
BLAST of FC931093 vs. ExPASy Swiss-Prot
Match: HOX24_ORYSJ (Homeobox-leucine zipper protein HOX24 OS=Oryza sativa subsp. japonica GN=HOX24 PE=2 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 4.003e-24
Identity = 59/106 (55.66%), Postives = 78/106 (73.58%), Query Frame = 2
Query:  245 FSDEQIRSLELMFE-NETRLEPRKKLQLAKELGLQPRQVAIWFQNKRARWKSKQLERDYNILQANFNNLASRFEALKKEKQALVIQLQKTNELLQNKPRREDQSPS 559
            F++EQ+RSLE  F     +LEPR+K +LA+ELGLQPRQVAIWFQNKRARW+SKQ+E DY  L+A ++ L +R E+L++EK AL  Q+   +EL      R+DQS S
Sbjct:   68 FTEEQVRSLETTFHARRAKLEPREKAELARELGLQPRQVAIWFQNKRARWRSKQIEHDYAALRAQYDALHARVESLRQEKLALADQV---DELRGKLNERQDQSGS 170          
BLAST of FC931093 vs. ExPASy Swiss-Prot
Match: HAT5_ARATH (Homeobox-leucine zipper protein HAT5 OS=Arabidopsis thaliana GN=HAT5 PE=1 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 1.165e-23
Identity = 53/125 (42.40%), Postives = 80/125 (64.00%), Query Frame = 2
Query:  254 EQIRSLELMFENETRLEPRKKLQLAKELGLQPRQVAIWFQNKRARWKSKQLERDYNILQANFNNLASRFEALKKEKQALVIQLQKTNELLQNKPRREDQSPSERQCCGQVEGVNSMESELDNGDR 628
            EQ+  LE  FE E +LEP +K QLAK+LGLQPRQVA+WFQN+RARWK+KQLERDY++L++ ++ L S ++++  +   L  ++    E LQ K    ++ P +     Q++ V    + +   DR
Sbjct:   75 EQVHLLEKSFETENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWKTKQLERDYDLLKSTYDQLLSNYDSIVMDNDKLRSEVTSLTEKLQGKQETANEPPGQVPEPNQLDPVYINAAAIKTEDR 199          
BLAST of FC931093 vs. ExPASy Swiss-Prot
Match: HOX20_ORYSJ (Homeobox-leucine zipper protein HOX20 OS=Oryza sativa subsp. japonica GN=HOX20 PE=2 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 5.780e-23
Identity = 54/131 (41.22%), Postives = 85/131 (64.89%), Query Frame = 2
Query:  248 SDEQIRSLELMFENETRLEPRKKLQLAKELGLQPRQVAIWFQNKRARWKSKQLERDYNILQANFNNLASRFEALKKEKQALVIQLQKTNELLQNKPR-------REDQSPSERQCCGQVEGVNSMESELDN 619
            S EQ+R+LE  FE E +LEP +K +LA++LGLQPRQVA+WFQN+RARWK+KQLERDY  L+ +++ L +  +AL+++K AL+ ++++    L ++         +E++ P+         G     SE D+
Sbjct:   48 SVEQVRALERSFETENKLEPERKARLARDLGLQPRQVAVWFQNRRARWKTKQLERDYAALRQSYDALRADHDALRRDKDALLAEIKELKGKLGDEDAAASFSSVKEEEDPAASDADPPATGAPQGSSESDS 178          
The following BLAST results are available for this feature:
BLAST of FC931093 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 47
Match NameE-valueIdentityDescription
ATHB7_ARATH2.042e-4456.04Homeobox-leucine zipper protein ATHB-7 OS=Arabidop... [more]
ATB12_ARATH7.514e-3963.49Homeobox-leucine zipper protein ATHB-12 OS=Arabido... [more]
HOX6_ORYSJ4.416e-3156.67Homeobox-leucine zipper protein HOX6 OS=Oryza sati... [more]
HOX6_ORYSI4.416e-3156.67Homeobox-leucine zipper protein HOX6 OS=Oryza sati... [more]
HOX22_ORYSJ1.018e-2749.24Homeobox-leucine zipper protein HOX22 OS=Oryza sat... [more]
HOX22_ORYSI1.018e-2749.24Homeobox-leucine zipper protein HOX22 OS=Oryza sat... [more]
HOX24_ORYSI2.347e-2455.66Homeobox-leucine zipper protein HOX24 OS=Oryza sat... [more]
HOX24_ORYSJ4.003e-2455.66Homeobox-leucine zipper protein HOX24 OS=Oryza sat... [more]
HAT5_ARATH1.165e-2342.40Homeobox-leucine zipper protein HAT5 OS=Arabidopsi... [more]
HOX20_ORYSJ5.780e-2341.22Homeobox-leucine zipper protein HOX20 OS=Oryza sat... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101D02EF PostHarvP1 Citrus clementina cDNA clone C34101D02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931093 ID=FC931093|Name=FC931093|organism=Citrus clementina|type=EST|length=710bp
GATAATTAAAACATGCACAGAGCACTTGACACAGCTTAAACATCCCCCAA
AAACACAGCCCCCTCTTTGAATGATTTTTTTTTAAAATTAGAATATACAA
AAATTATCTAGTCACCAGCACAAATTCCGACTAAAGATGTTAGATGGGGG
CGAATATTCTCCGGCGGCTGAGCCATACAGCTGCATGAACGAGATCACAA
CAACAACGACAACCAGAAAGAAGAAGTGCAAGAACAAGAGGAGGTTCAGT
GATGAACAGATCAGATCATTGGAACTCATGTTTGAAAACGAAACTAGACT
CGAGCCTCGAAAGAAGCTGCAGTTGGCTAAAGAACTTGGGTTGCAGCCTC
GTCAGGTTGCAATATGGTTTCAGAATAAGAGAGCTAGATGGAAGTCGAAG
CAGCTTGAACGAGACTACAACATACTTCAAGCCAATTTCAATAACCTTGC
TTCAAGGTTCGAAGCTCTGAAGAAAGAAAAACAAGCCTTGGTTATTCAGT
TGCAAAAGACGAATGAGTTGTTGCAAAATAAGCCACGACGGGAGGATCAG
AGTCCGAGTGAGAGGCAGTGTTGCGGTCAAGTTGAAGGTGTAAACAGCAT
GGAGAGCGAATTGGACAATGGAGACAGGGACACCAACAAGTGTGAATCAG
AAGTGAAGCCAAGCTTGTCAGCAGAACTGAAGCTAGGTGTTTTGTCAGAT
GATGATAGCA
back to top