FC931098

Overview
NameFC931098
Unique NameFC931098
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length710
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC931098 vs. ExPASy Swiss-Prot
Match: ALF_ASPOR (Fructose-bisphosphate aldolase OS=Aspergillus oryzae GN=fbaA PE=2 SV=2)

HSP 1 Score: 328.561 bits (841), Expect = 2.084e-89
Identity = 163/223 (73.09%), Postives = 181/223 (81.17%), Query Frame = 1
Query:   40 MGVLEQLNRKSGVIVGDDVLRLFEYAKQNGFAIPAINVTSSSTVVASLEAARDQKCPVILQVSQGGAAFFAGKGVSNEGQKXXXXXXXXXXHYIRSVATAYDIPVILHTDHCAKKLLPWLDGMLDADEAYFKLHNEPLFSSHMIDLSEESFDYNINTTAAYFKRAAPMKQWLEMEIGITXXXXXXXXXXXXXXXSLYTQPEDILVIQKTLAAISPYFSHCAGF 708
            +GVLE+L+RK+GVIVGDDVLRLFE+A+QN +AIPA+NVTSSSTVVASLEAARDQ CP++LQ+SQGGAA+FAGKGVSN+GQ+          HYIRS+A AY IPV+LHTDHCAKKLLPWLDG+LD DE YFKLH EPLFSSHMIDLSEE  DYNI TTAAY KRAAPMKQWLEMEIGIT               SLYTQPEDIL I K L+ ISPYFS  AGF
Sbjct:    3 VGVLEKLSRKTGVIVGDDVLRLFEHAQQNNYAIPAVNVTSSSTVVASLEAARDQNCPIVLQLSQGGAAYFAGKGVSNDGQQASIAGGIAAAHYIRSLAPAYGIPVVLHTDHCAKKLLPWLDGLLDEDERYFKLHGEPLFSSHMIDLSEEPVDYNIQTTAAYLKRAAPMKQWLEMEIGITGGEEDGVNNEDVDNNSLYTQPEDILAIHKALSPISPYFSIAAGF 225          
BLAST of FC931098 vs. ExPASy Swiss-Prot
Match: ALF1_PARBA (Fructose-bisphosphate aldolase 1 OS=Paracoccidioides brasiliensis (strain ATCC MYA-826 / Pb01) GN=FBA1 PE=1 SV=3)

HSP 1 Score: 313.923 bits (803), Expect = 5.311e-85
Identity = 160/223 (71.75%), Postives = 177/223 (79.37%), Query Frame = 1
Query:   40 MGVLEQLNRKSGVIVGDDVLRLFEYAKQNGFAIPAINVTSSSTVVASLEAARDQKCPVILQVSQGGAAFFAGKGVSNEGQKXXXXXXXXXXHYIRSVATAYDIPVILHTDHCAKKLLPWLDGMLDADEAYFKLHNEPLFSSHMIDLSEESFDYNINTTAAYFKRAAPMKQWLEMEIGITXXXXXXXXXXXXXXXSLYTQPEDILVIQKTLAAISPYFSHCAGF 708
            MGV + L+RK+GVIVGDDVLRLF++A++  FAIPAINVTSSSTVVA+LEAARD+  P+ILQVSQGGAAFFAGKGV N  Q+          HYIRS+A +Y IPV+LHTDHCAKKLLPWLDGMLDADE YFKLHNEPLFSSHMIDLSEES ++NI TTA Y KRAAPMKQWLEMEIGIT               SLYTQPEDI  I KTL+AISPYFS  AGF
Sbjct:    1 MGVKDILSRKTGVIVGDDVLRLFQHAQEKVFAIPAINVTSSSTVVAALEAARDKNSPIILQVSQGGAAFFAGKGVPNGKQEASVAGAIAAAHYIRSIAPSYGIPVVLHTDHCAKKLLPWLDGMLDADECYFKLHNEPLFSSHMIDLSEESVEWNIETTAKYLKRAAPMKQWLEMEIGITGGEEDGVNNESVDNNSLYTQPEDIYTIYKTLSAISPYFSIAAGF 223          
BLAST of FC931098 vs. ExPASy Swiss-Prot
Match: ALF2_PARBA (Fructose-bisphosphate aldolase 2 OS=Paracoccidioides brasiliensis (strain ATCC MYA-826 / Pb01) GN=FBA2 PE=2 SV=2)

HSP 1 Score: 285.804 bits (730), Expect = 1.549e-76
Identity = 156/225 (69.33%), Postives = 171/225 (76.00%), Query Frame = 1
Query:   40 MGVLEQLNRKSGVIVGDDVLRLFEYAKQNGFAIPAINVTSSSTVVASLEAARDQKCPVILQVSQGGAAFFAGKG--VSNEGQKXXXXXXXXXXHYIRSVATAYDIPVILHTDHCAKKLLPWLDGMLDADEAYFKLHNEPLFSSHMIDLSEESFDYNINTTAAYFKRAAPMKQWLEMEIGITXXXXXXXXXXXXXXXSLYTQPEDILVIQKTLAAISPYFSHCAGF 708
            MGV + L+RK+GVIVGDDVLRLF++A++N FAIPAI VTSSST  A LEAARD K P++LQ S G AA+FAGKG  VSN+GQ           HYIRS A AY IPV+LHTDHCAKKLLPWLDGMLDADE Y KLHNEPLFSSHMIDLSEES ++NI TTA Y KRAAPMKQWLEMEIGIT               SLYTQPEDI  I KTL+AISPYFS  AGF
Sbjct:    1 MGVKDLLSRKTGVIVGDDVLRLFQHAQENVFAIPAIMVTSSSTGSA-LEAARD-KSPIVLQTSNG-AAYFAGKGKGVSNDGQSVAGSIAIAAAHYIRSQAPAYGIPVVLHTDHCAKKLLPWLDGMLDADECYSKLHNEPLFSSHMIDLSEESVEWNIETTAKYLKRAAPMKQWLEMEIGITGGEEDGVNNESVDNNSLYTQPEDIYTIYKTLSAISPYFSIAAGF 222          
BLAST of FC931098 vs. ExPASy Swiss-Prot
Match: ALF_YEAST (Fructose-bisphosphate aldolase OS=Saccharomyces cerevisiae GN=FBA1 PE=1 SV=3)

HSP 1 Score: 274.633 bits (701), Expect = 3.571e-73
Identity = 140/223 (62.78%), Postives = 160/223 (71.75%), Query Frame = 1
Query:   40 MGVLEQLNRKSGVIVGDDVLRLFEYAKQNGFAIPAINVTSSSTVVASLEAARDQKCPVILQVSQGGAAFFAGKGVSNEGQKXXXXXXXXXXHYIRSVATAYDIPVILHTDHCAKKLLPWLDGMLDADEAYFKLHNEPLFSSHMIDLSEESFDYNINTTAAYFKRAAPMKQWLEMEIGITXXXXXXXXXXXXXXXSLYTQPEDILVIQKTLAAISPYFSHCAGF 708
            MGV + L RK+GVIVG+DV  LF YAK++ FAIPAINVTSSST VA+LEAARD K P+ILQ S GGAA+FAGKG+SNEGQ           HYIRS+A AY IPV+LH+DHCAKKLLPW DGML+ADEAYFK H EPLFSSHM+DLSEE+ + NI+T   YFKR A M QWLEMEIGIT                LYT+PE +  + K L  ISP FS  A F
Sbjct:    1 MGVEQILKRKTGVIVGEDVHNLFTYAKEHKFAIPAINVTSSSTAVAALEAARDSKSPIILQTSNGGAAYFAGKGISNEGQNASIKGAIAAAHYIRSIAPAYGIPVVLHSDHCAKKLLPWFDGMLEADEAYFKEHGEPLFSSHMLDLSEETDEENISTCVKYFKRMAAMDQWLEMEIGITGGEEDGVNNENADKEDLYTKPEQVYNVYKALHPISPNFSIAAAF 223          
BLAST of FC931098 vs. ExPASy Swiss-Prot
Match: ALF_NEUCR (Fructose-bisphosphate aldolase OS=Neurospora crassa GN=fba-1 PE=3 SV=2)

HSP 1 Score: 273.478 bits (698), Expect = 7.954e-73
Identity = 138/225 (61.33%), Postives = 161/225 (71.56%), Query Frame = 1
Query:   40 MGVLEQLNRKSGVIVGDDVLRLFEYAKQNGFAIPAINVTSSSTVVASLEAARDQKCPVILQVSQGGAAFFAGKGVSNEGQKXXXXXXXXXX--HYIRSVATAYDIPVILHTDHCAKKLLPWLDGMLDADEAYFKLHNEPLFSSHMIDLSEESFDYNINTTAAYFKRAAPMKQWLEMEIGITXXXXXXXXXXXXXXXSLYTQPEDILVIQKTLAAISPYFSHCAGF 708
            MG+ ++LN  +GV+ GDDVL+LF+YA++  FAIPA NVTSSST VA+LEAARDQK P+ILQ SQGGAAFFAGKG+ +  +K            HYIRS+A  Y IPV+LHTDHCAKKLLPWLDGML+ DE +FK +  PLFSSHMIDLSEE  + NI+T   Y KR APMKQWLEMEIGIT               SLYTQPEDI  I++    ISPYFS  AGF
Sbjct:    1 MGIFDELNLPAGVLYGDDVLKLFQYAREKQFAIPACNVTSSSTAVAALEAARDQKAPIILQTSQGGAAFFAGKGIKDSAEKREASVAGAIAAAHYIRSIAPIYGIPVVLHTDHCAKKLLPWLDGMLEEDEKFFKANGVPLFSSHMIDLSEEPVEENISTCVKYLKRMAPMKQWLEMEIGITGGEEDGVDNSEVDNASLYTQPEDIWQIEEAFRPISPYFSIAAGF 225          
BLAST of FC931098 vs. ExPASy Swiss-Prot
Match: ALF_KLULA (Fructose-bisphosphate aldolase OS=Kluyveromyces lactis GN=FBA1 PE=3 SV=2)

HSP 1 Score: 263.848 bits (673), Expect = 6.303e-70
Identity = 135/223 (60.54%), Postives = 154/223 (69.06%), Query Frame = 1
Query:   40 MGVLEQLNRKSGVIVGDDVLRLFEYAKQNGFAIPAINVTSSSTVVASLEAARDQKCPVILQVSQGGAAFFAGKGVSNEGQKXXXXXXXXXXHYIRSVATAYDIPVILHTDHCAKKLLPWLDGMLDADEAYFKLHNEPLFSSHMIDLSEESFDYNINTTAAYFKRAAPMKQWLEMEIGITXXXXXXXXXXXXXXXSLYTQPEDILVIQKTLAAISPYFSHCAGF 708
            M   + L RK+GVIVGDDV  LF+YAK++ FAIPAINVTSSSTVVA+LEAARD K P+ILQ S GGAA+FAGKGVSNEGQ           HYIRS+A AY IPV+LHTDHCAKKLLPW DGML ADE YF  H EPLFSSHM+DLSEE+ + NI     YF R A + QWLEMEIGIT                LYT PE +  + + L+ ISP FS  + F
Sbjct:    1 MPAQDVLTRKTGVIVGDDVKALFDYAKEHKFAIPAINVTSSSTVVAALEAARDNKSPIILQTSNGGAAYFAGKGVSNEGQNASIRGSIAAAHYIRSIAPAYGIPVVLHTDHCAKKLLPWFDGMLKADEEYFAKHGEPLFSSHMLDLSEETDEENIGLCVKYFTRMAKIHQWLEMEIGITGGEEDGVNNEGTSNDKLYTTPETVFSVHEALSKISPNFSIASAF 223          
BLAST of FC931098 vs. ExPASy Swiss-Prot
Match: ALF_SCHPO (Fructose-bisphosphate aldolase OS=Schizosaccharomyces pombe GN=fba1 PE=1 SV=2)

HSP 1 Score: 258.07 bits (658), Expect = 3.458e-68
Identity = 128/223 (57.40%), Postives = 159/223 (71.30%), Query Frame = 1
Query:   40 MGVLEQLNRKSGVIVGDDVLRLFEYAKQNGFAIPAINVTSSSTVVASLEAARDQKCPVILQVSQGGAAFFAGKGVSNEGQKXXXXXXXXXXHYIRSVATAYDIPVILHTDHCAKKLLPWLDGMLDADEAYFKLHNEPLFSSHMIDLSEESFDYNINTTAAYFKRAAPMKQWLEMEIGITXXXXXXXXXXXXXXXSLYTQPEDILVIQKTLAAISPYFSHCAGF 708
            MG+L+ +   +GVI GD+VL+LF YA+++GFAIPAINVTSSST +A+LEAAR+ + P+ILQ S GGA FFAGK  SNEGQK          HYIRS+A  + +PV++H+DHCAKKLLPW+DGM +ADEAYFK+H EPLFSSHM+DLSEE    NI     Y KRA PMK W+EMEIGIT                LYTQPEDI  + + L++++PYFS  A F
Sbjct:    1 MGILDIV--PTGVITGDNVLKLFTYAREHGFAIPAINVTSSSTAIAALEAAREARSPIILQTSNGGAHFFAGKESSNEGQKASIAGSIAAAHYIRSIAPFFGVPVVMHSDHCAKKLLPWMDGMFEADEAYFKIHGEPLFSSHMLDLSEEPKKENIAQVKEYCKRAVPMKIWIEMEIGITGGEEDGVDNSHVSHTELYTQPEDIWDVYRELSSVTPYFSIAAAF 221          
BLAST of FC931098 vs. ExPASy Swiss-Prot
Match: ALF_CANAL (Fructose-bisphosphate aldolase OS=Candida albicans GN=FBA1 PE=1 SV=2)

HSP 1 Score: 251.136 bits (640), Expect = 4.228e-66
Identity = 129/214 (60.28%), Postives = 148/214 (69.16%), Query Frame = 1
Query:   67 KSGVIVGDDVLRLFEYAKQNGFAIPAINVTSSSTVVASLEAARDQKCPVILQVSQGGAAFFAGKGVSNEGQKXXXXXXXXXXHYIRSVATAYDIPVILHTDHCAKKLLPWLDGMLDADEAYFKLHNEPLFSSHMIDLSEESFDYNINTTAAYFKRAAPMKQWLEMEIGITXXXXXXXXXXXXXXXSLYTQPEDILVIQKTLAAISPYFSHCAGF 708
            KSGVI G DV  LF+YA++ GFAIPAINVTSSSTVVA+LEAARD K P+ILQ SQGGAA+FAGKGV N+ Q           HYIR++A  Y IPV+LHTDHCAKKLLPW DGML ADE +F     PLFSSHM+DLSEE+ D NI T A YF+R A M QWLEMEIGIT               +LYT PE +  + ++L  ISP FS  A F
Sbjct:    9 KSGVIYGKDVKDLFDYAQEKGFAIPAINVTSSSTVVAALEAARDNKAPIILQTSQGGAAYFAGKGVDNKDQAASIAGSIAAAHYIRAIAPTYGIPVVLHTDHCAKKLLPWFDGMLKADEEFFAKTGTPLFSSHMLDLSEETDDENIATCAKYFERMAKMGQWLEMEIGITGGEEDGVNNEHVEKDALYTSPETVFAVYESLHKISPNFSIAAAF 222          
BLAST of FC931098 vs. ExPASy Swiss-Prot
Match: ALF_EDWI9 (Fructose-bisphosphate aldolase OS=Edwardsiella ictaluri (strain 93-146) GN=fba PE=3 SV=2)

HSP 1 Score: 201.06 bits (510), Expect = 5.017e-51
Identity = 102/214 (47.66%), Postives = 134/214 (62.62%), Query Frame = 1
Query:   67 KSGVIVGDDVLRLFEYAKQNGFAIPAINVTSSSTVVASLEAARDQKCPVILQVSQGGAAFFAGKGVSNEGQKXXXXXXXXXXHYIRSVATAYDIPVILHTDHCAKKLLPWLDGMLDADEAYFKLHNEPLFSSHMIDLSEESFDYNINTTAAYFKRAAPMKQWLEMEIGITXXXXXXXXXXXXXXXSLYTQPEDILVIQKTLAAISPYFSHCAGF 708
            K GVI GDDV ++F+ AK+N FA+PA+N   + ++ A +EAA   + P+I+Q S GGAAF AGKG+  EGQ+          H++  +A  Y +PVILHTDHCAKKLLPWLDG+LDA E +F    +PLFSSHMIDLSEES + NI   + Y  R + +   LE+E+G T               +LYTQPED+      L+AISP F+  A F
Sbjct:    9 KPGVIFGDDVQKVFQVAKENKFALPAVNCVGTDSINAVMEAAAKVRAPIIVQFSNGGAAFIAGKGLKLEGQQGAILGAIAGAHHVHQMAEYYGVPVILHTDHCAKKLLPWLDGLLDAGEKHFAATGKPLFSSHMIDLSEESLEENIEICSQYLARMSKIGMTLELELGCTGGEEDGVDNSHLDNSALYTQPEDVDYAFTKLSAISPRFTIAASF 222          
BLAST of FC931098 vs. ExPASy Swiss-Prot
Match: ALF_SHIFL (Fructose-bisphosphate aldolase class 2 OS=Shigella flexneri GN=fbaA PE=3 SV=2)

HSP 1 Score: 192.2 bits (487), Expect = 2.330e-48
Identity = 100/215 (46.51%), Postives = 131/215 (60.93%), Query Frame = 1
Query:   67 KSGVIVGDDVLRLFEYAKQNGFAIPAINVTSSSTVVASLEAARDQKCPVILQVSQGGAAFFAGKGVSNE-GQKXXXXXXXXXXHYIRSVATAYDIPVILHTDHCAKKLLPWLDGMLDADEAYFKLHNEPLFSSHMIDLSEESFDYNINTTAAYFKRAAPMKQWLEMEIGITXXXXXXXXXXXXXXXSLYTQPEDILVIQKTLAAISPYFSHCAGF 708
            K GVI GDDV ++F+ AK+N FA+PA+N   + ++ A LE A   K PVI+Q S GGA+F AGKGV ++  Q           H++  +A  Y +PVILHTDHCAKKLLPW+DG+LDA E +F    +PLFSSHMIDLSEES   NI   + Y +R + +   LE+E+G T               +LYTQPED+      L+ ISP F+  A F
Sbjct:    9 KPGVITGDDVQKVFQVAKENNFALPAVNCVGTDSINAVLETAAKVKAPVIVQFSNGGASFIAGKGVKSDVPQGAAILGAISGAHHVHQMAEHYGVPVILHTDHCAKKLLPWIDGLLDAGEKHFAATGKPLFSSHMIDLSEESLQENIEICSKYLERMSKIGMTLEIELGCTGGEEDGVDNSHMDASALYTQPEDVDYAYTELSKISPRFTIAASF 223          
The following BLAST results are available for this feature:
BLAST of FC931098 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
ALF_ASPOR2.084e-8973.09Fructose-bisphosphate aldolase OS=Aspergillus oryz... [more]
ALF1_PARBA5.311e-8571.75Fructose-bisphosphate aldolase 1 OS=Paracoccidioid... [more]
ALF2_PARBA1.549e-7669.33Fructose-bisphosphate aldolase 2 OS=Paracoccidioid... [more]
ALF_YEAST3.571e-7362.78Fructose-bisphosphate aldolase OS=Saccharomyces ce... [more]
ALF_NEUCR7.954e-7361.33Fructose-bisphosphate aldolase OS=Neurospora crass... [more]
ALF_KLULA6.303e-7060.54Fructose-bisphosphate aldolase OS=Kluyveromyces la... [more]
ALF_SCHPO3.458e-6857.40Fructose-bisphosphate aldolase OS=Schizosaccharomy... [more]
ALF_CANAL4.228e-6660.28Fructose-bisphosphate aldolase OS=Candida albicans... [more]
ALF_EDWI95.017e-5147.66Fructose-bisphosphate aldolase OS=Edwardsiella ict... [more]
ALF_SHIFL2.330e-4846.51Fructose-bisphosphate aldolase class 2 OS=Shigella... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101D08EF PostHarvP1 Citrus clementina cDNA clone C34101D08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931098 ID=FC931098|Name=FC931098|organism=Citrus clementina|type=EST|length=710bp
GAGATTTCTAATCAAAATCTTTTTTATACAATTGTCACAATGGGTGTCCT
TGAGCAACTTAACCGCAAGTCCGGCGTCATTGTTGGTGACGATGTTCTCC
GTCTTTTCGAGTACGCTAAGCAGAATGGTTTTGCCATCCCCGCCATTAAC
GTCACCTCCTCTTCCACTGTTGTTGCATCTCTCGAGGCTGCTCGGGACCA
GAAATGTCCCGTTATCCTGCAGGTCTCCCAGGGTGGTGCCGCTTTCTTCG
CGGGTAAGGGTGTGAGCAACGAGGGCCAGAAGGCCTCCATTGCTGGTGCC
ATTGCCGCGGCCCACTACATCCGTAGCGTGGCCACCGCCTACGATATCCC
CGTCATCCTTCACACCGATCACTGCGCCAAGAAGCTCCTCCCTTGGCTCG
ATGGCATGCTCGATGCCGATGAGGCTTACTTCAAGCTGCACAACGAGCCC
CTCTTCTCCTCCCACATGATTGATCTGTCTGAGGAGTCCTTTGACTACAA
CATCAACACCACCGCCGCCTACTTCAAGCGCGCTGCTCCCATGAAGCAGT
GGCTCGAGATGGAGATTGGTATCACCGGTGGTGAGGAGGATGGTGTCAAC
AACGAGGATGTTGACAACAACTCCCTCTACACCCAGCCCGAGGACATCCT
GGTCATCCAGAAGACCCTCGCTGCCATCAGCCCCTACTTCTCCCATTGCG
CTGGCTTTGG
back to top