FC931105

Overview
NameFC931105
Unique NameFC931105
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length718
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig7178 contig Ccv1_Contig7178:666..1383. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931105 vs. ExPASy Swiss-Prot
Match: GI1L3_ARATH (Probable gibberellin receptor GID1L3 OS=Arabidopsis thaliana GN=GID1L3 PE=1 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 2.271e-35
Identity = 92/231 (39.83%), Postives = 128/231 (55.41%), Query Frame = 3
Query:   15 LPTILHFHGGGFCVSQADWYMYYHVYTKLAKSVPAICVSVYLRRAPEHRLPAAFDDGFEALLWLRSLSLAQAQARENNWLTEHVDFQ-RVFLIGDSSGGNVVHEVAARAGDADLSPLRVAGAIPIHPGFLRQERSKSELENPQSPLLTLDMVDKFLSFALPLNSDKGHPYTCPMGPAASPIDGLKLPPFLLCVAGNDLIKDTEMEYYEAMKKAGKDVELLVNPGMGHSFYL 704
            +P I+ FHGG F  S A+  +Y  +  +L     A+ VSV  RRAPE+R P A+DDG+  L W+ S S          WL    D + R+FL GDSSGGN+VH VA RA +   S + V G I ++P F   ER++SE        +T+   D +    LP   D+ HP   P GP +  ++GL  P  L+ VAG DLI+D +++Y E +KKAG++V+LL        FYL
Sbjct:  104 VPVIVFFHGGSFAHSSANSAIYDTLCRRLVGLCGAVVVSVNYRRAPENRYPCAYDDGWAVLKWVNSSS----------WLRSKKDSKVRIFLAGDSSGGNIVHNVAVRAVE---SRIDVLGNILLNPMFGGTERTESEKRLDGKYFVTVRDRDWYWRAFLPEGEDREHPACSPFGPRSKSLEGLSFPKSLVVVAGLDLIQDWQLKYAEGLKKAGQEVKLLYLEQATIGFYL 321          
BLAST of FC931105 vs. ExPASy Swiss-Prot
Match: GI1L1_ARATH (Probable gibberellin receptor GID1L1 OS=Arabidopsis thaliana GN=GID1L1 PE=1 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 8.079e-33
Identity = 87/231 (37.66%), Postives = 123/231 (53.25%), Query Frame = 3
Query:   15 LPTILHFHGGGFCVSQADWYMYYHVYTKLAKSVPAICVSVYLRRAPEHRLPAAFDDGFEALLWLRSLSLAQAQARENNWLTEHVDFQ-RVFLIGDSSGGNVVHEVAARAGDADLSPLRVAGAIPIHPGFLRQERSKSELENPQSPLLTLDMVDKFLSFALPLNSDKGHPYTCPMGPAASPIDGLKLPPFLLCVAGNDLIKDTEMEYYEAMKKAGKDVELLVNPGMGHSFYL 704
            +P IL FHGG F  S A+  +Y  +  +L      + VSV  RRAPE+  P A+DDG+ AL W+ S S          WL    D +  +FL GDSSGGN+ H VA RAG++ +    V G I ++P F   ER++SE        +T+   D +    LP   D+ HP   P  P    ++G+  P  L+ VAG DLI+D ++ Y E +KKAG++V+L+        FYL
Sbjct:  106 VPVILFFHGGSFAHSSANSAIYDTLCRRLVGLCKCVVVSVNYRRAPENPYPCAYDDGWIALNWVNSRS----------WLKSKKDSKVHIFLAGDSSGGNIAHNVALRAGESGID---VLGNILLNPMFGGNERTESEKSLDGKYFVTVRDRDWYWKAFLPEGEDREHPACNPFSPRGKSLEGVSFPKSLVVVAGLDLIRDWQLAYAEGLKKAGQEVKLMHLEKATVGFYL 323          
BLAST of FC931105 vs. ExPASy Swiss-Prot
Match: GI1L2_ARATH (Probable gibberellin receptor GID1L2 OS=Arabidopsis thaliana GN=GID1L2 PE=1 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 2.350e-32
Identity = 81/219 (36.99%), Postives = 117/219 (53.42%), Query Frame = 3
Query:   15 LPTILHFHGGGFCVSQADWYMYYHVYTKLAKSVPAICVSVYLRRAPEHRLPAAFDDGFEALLWLRSLSLAQAQARENNWLTEHVDFQRVFLIGDSSGGNVVHEVAARAGDADLSPLRVAGAIPIHPGFLRQERSKSELENPQSPLLTLDMVDKFLSFALPLNSDKGHPYTCPMGPAASPIDGLKLPPFLLCVAGNDLIKDTEMEYYEAMKKAGKDVELL 671
            +P ++ FHGG F  S A+  +Y     +L      + VSV  RR+PEHR P A+DDG+ AL W++S    Q+    N +         V+L GDSSGGN+ H VA RA +  +   +V G I +HP F  QER++SE        +T+   D +    LP   D+ HP   P GP    + G+  P  L+ VAG DL++D ++ Y + +KK G +V LL
Sbjct:  106 VPVLIFFHGGSFTHSSANSAIYDTFCRRLVTICGVVVVSVDYRRSPEHRYPCAYDDGWNALNWVKSRVWLQSGKDSNVY---------VYLAGDSSGGNIAHNVAVRATNEGV---KVLGNILLHPMFGGQERTQSEKTLDGKYFVTIQDRDWYWRAYLPEGEDRDHPACNPFGPRGQSLKGVNFPKSLVVVAGLDLVQDWQLAYVDGLKKTGLEVNLL 312          
BLAST of FC931105 vs. ExPASy Swiss-Prot
Match: GID1_ORYSJ (Gibberellin receptor GID1 OS=Oryza sativa subsp. japonica GN=GID1 PE=1 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 3.177e-29
Identity = 81/229 (35.37%), Postives = 115/229 (50.22%), Query Frame = 3
Query:   18 PTILHFHGGGFCVSQADWYMYYHVYTKLAKSVPAICVSVYLRRAPEHRLPAAFDDGFEALLWLRSLSLAQAQARENNWLTEHVDFQRVFLIGDSSGGNVVHEVAARAGDADLSPLRVAGAIPIHPGFLRQERSKSELENPQSPLLTLDMVDKFLSFALPLNSDKGHPYTCPMGPAASPIDGLKLPPFLLCVAGNDLIKDTEMEYYEAMKKAGKDVELLVNPGMGHSFYL 704
            P I+ FHGG F  S A   +Y  +  +  K    + VSV  RRAPEHR P A+DDG+ AL W+ S    ++               RVFL GDSSGGN+ H VA RA D     ++V G I ++  F   ER++SE        +TL   D +    LP ++D+ HP   P GP    + GL     L+ V+G DL  D ++ Y +A+++ G  V+++        FYL
Sbjct:  114 PVIIFFHGGSFVHSSASSTIYDSLCRRFVKLSKGVVVSVNYRRAPEHRYPCAYDDGWTALKWVMSQPFMRSGGDAQ---------ARVFLSGDSSGGNIAHHVAVRAAD---EGVKVCGNILLNAMFGGTERTESERRLDGKYFVTLQDRDWYWKAYLPEDADRDHPACNPFGPNGRRLGGLPFAKSLIIVSGLDLTCDRQLAYADALREDGHHVKVVQCENATVGFYL 330          
BLAST of FC931105 vs. ExPASy Swiss-Prot
Match: YKN2_SCHPO (AB hydrolase superfamily protein B1A11.02 OS=Schizosaccharomyces pombe GN=SPAPB1A11.02 PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.341e-11
Identity = 64/238 (26.89%), Postives = 106/238 (44.54%), Query Frame = 3
Query:   24 ILHFHGGGFC---VSQADWYMYYHVYTKLAKSVPAICVSVYLRRAPEHRLPAAFDDGFEALLWLRSLSLAQAQARENNWLTEHVDFQRVFLIGDSSGGNVVHEVAARAGDADLSPLRVAG---AIP--IHPGFLRQE---RSKSELENPQSPLLTLDMVDKFLSFALPLNSDKGHPYTCPMGPAASPIDGLKLPPFLLCVAGNDLIKDTEMEYYEAMKKAGKDVELLVNPGMGHSFYL 704
            ++ +H  G+C   V   D      ++  L      +CVSV  R APE + P A +D  ++  W+ S ++ +  A            +  FL G S+GGN V  ++  A D  + P  + G    +P  IHP  L +E   + +S  E   +P++T  ++D F     P       P +  + P   P     LPP      G D ++D  + Y +A+K AG +  L+V  G+ H F++
Sbjct:   93 MVFYHSSGWCMRGVRDDD-----SLFKILTPKFGCVCVSVDYRLAPESKFPVAHNDAIDSFKWVAS-NIEKLGANPK---------RGFFLGGASAGGNFVSVLSHIARDEKIKP-ELTGLWHMVPTLIHPADLDEETMAQFRSYKETIHAPVITPKIMDIFFENYQPT------PKSPLVNPLYYPTGHKDLPPSFFQCCGWDPLRDEGIAYEKALKAAGNETRLIVYEGVPHCFWV 308          
The following BLAST results are available for this feature:
BLAST of FC931105 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
GI1L3_ARATH2.271e-3539.83Probable gibberellin receptor GID1L3 OS=Arabidopsi... [more]
GI1L1_ARATH8.079e-3337.66Probable gibberellin receptor GID1L1 OS=Arabidopsi... [more]
GI1L2_ARATH2.350e-3236.99Probable gibberellin receptor GID1L2 OS=Arabidopsi... [more]
GID1_ORYSJ3.177e-2935.37Gibberellin receptor GID1 OS=Oryza sativa subsp. j... [more]
YKN2_SCHPO1.341e-1126.89AB hydrolase superfamily protein B1A11.02 OS=Schiz... [more]
back to top
Properties
Property NameValue
Genbank descriptionC34101E03EF PostHarvP1 Citrus clementina cDNA clone C34101E03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931105 ID=FC931105|Name=FC931105|organism=Citrus clementina|type=EST|length=718bp
AAGAAAAGAAGAAGCTACCAACCATCCTTCACTTTCATGGGGGTGGTTTT
TGCGTTAGCCAAGCTGATTGGTACATGTACTATCACGTTTACACGAAGCT
TGCAAAATCTGTCCCGGCTATCTGTGTCTCCGTCTATCTCCGGCGGGCCC
CGGAGCACCGCCTCCCGGCCGCTTTCGACGATGGTTTCGAAGCCCTCCTT
TGGCTCCGGTCACTATCACTGGCTCAGGCTCAGGCTCGGGAGAATAATTG
GCTGACTGAACATGTGGATTTTCAACGCGTCTTCCTCATTGGAGACAGCT
CCGGAGGGAACGTAGTGCATGAAGTGGCGGCACGTGCAGGTGACGCGGAC
TTGAGCCCGTTGCGTGTGGCCGGAGCGATTCCGATTCATCCGGGTTTCCT
CCGGCAGGAAAGGAGCAAGTCGGAGTTGGAAAACCCGCAGTCACCTCTTC
TGACTCTGGACATGGTGGACAAGTTCTTGAGCTTTGCCCTGCCGTTGAAC
AGCGACAAGGGGCATCCGTACACCTGTCCAATGGGGCCGGCTGCGTCGCC
GATCGACGGTCTGAAGCTGCCTCCGTTTCTGCTGTGCGTGGCGGGTAATG
ACTTGATTAAGGACACTGAGATGGAATATTATGAAGCCATGAAAAAGGCT
GGAAAGGATGTGGAGTTGTTGGTGAATCCTGGAATGGGTCACAGTTTTTA
TCTCGACAAGATGCAGTC
back to top