FC931133

Overview
NameFC931133
Unique NameFC931133
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length687
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC931133 vs. ExPASy Swiss-Prot
Match: TCP15_ARATH (Transcription factor TCP15 OS=Arabidopsis thaliana GN=TCP15 PE=2 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 4.422e-35
Identity = 64/175 (36.57%), Postives = 81/175 (46.29%), Query Frame = 3
Query:  159 FSVDSRTRHKSDGETIEWLLQQAEPAVIAATGTGTIPANFTXXXXXXXXXXXXXXATHLRNTYFNPNFGSQQLMRNMRSEWERTLIDNNCNSLSFPLTGGNVNAMLQSNKQELRDNNTIATTTTSLDVSEADTGMGRKRRPDQELSQNNQMGSYLVQSSTGSIPASHSTIPATFW 683
            F +     HKSDGETIEWLLQQAEPAVIAATGTGTIPANFT              A HLR T  +  F S                     S++  L           ++ ++R  N   ++++S                  +L  +NQMG+YLVQS+ GS+P S S   A FW
Sbjct:   77 FQLTRELGHKSDGETIEWLLQQAEPAVIAATGTGTIPANFTSLNISLRSSRSSLSAAHLRTTPSSYYFHSPH------------------QSMTHHL----------QHQHQVRPKNESHSSSSS----------------SSQLLDHNQMGNYLVQSTAGSLPTSQSPATAPFW 207          

HSP 2 Score: 76.2554 bits (186), Expect = 4.422e-35
Identity = 36/39 (92.31%), Postives = 37/39 (94.87%), Query Frame = 1
Query:   64 PVPKRTSTKDRHTKVEGRGRRIRMPAACAARVFQLTQEL 180
            P PKRTSTKDRHTKVEGRGRRIRMPA CAARVFQLT+EL
Sbjct:   45 PPPKRTSTKDRHTKVEGRGRRIRMPAMCAARVFQLTREL 83          
BLAST of FC931133 vs. ExPASy Swiss-Prot
Match: TCP14_ARATH (Transcription factor TCP14 OS=Arabidopsis thaliana GN=TCP14 PE=2 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 7.373e-28
Identity = 65/203 (32.02%), Postives = 86/203 (42.36%), Query Frame = 3
Query:  159 FSVDSRTRHKSDGETIEWLLQQAEPAVIAATGTGTIPANFT-XXXXXXXXXXXXXXATHLRN--TYFNPNFGSQQLMRNMRSEWER---------------------TLIDNNCNSLSFPLTGGNVNAMLQSNKQELRDNNTIATTTTSLDVSEADTGMGRKRRPDQELSQNNQMGSYLVQSSTG---SIPASHSTIPATFWM 686
            F +     HKSDGETIEWLLQQAEP+VIAATGTGTIPANFT                +H R+  + F+PN      M   + + +R                       IDN   + SF             + +EL         TTS D+ +            Q+  Q++Q+G Y +QSS     +  A+   IP  FWM
Sbjct:  142 FQLTRELGHKSDGETIEWLLQQAEPSVIAATGTGTIPANFTSLNISLRSSGSSMSLPSHFRSAASTFSPNNIFSPAMLQQQQQQQRGGGVGFHHPHLQGRAPTSSLFPGIDNFTPTTSFLNFHNPTKQEGDQDSEELNSEKKRRIQTTS-DLHQ-----------QQQQHQHDQIGGYTLQSSNSGSTATAAAAQQIPGNFWM 332          

HSP 2 Score: 69.3218 bits (168), Expect = 7.373e-28
Identity = 33/39 (84.62%), Postives = 35/39 (89.74%), Query Frame = 1
Query:   64 PVPKRTSTKDRHTKVEGRGRRIRMPAACAARVFQLTQEL 180
            P  KR STKDRHTKV+GRGRRIRMPA CAARVFQLT+EL
Sbjct:  110 PPLKRASTKDRHTKVDGRGRRIRMPALCAARVFQLTREL 148          
BLAST of FC931133 vs. ExPASy Swiss-Prot
Match: TCP8_ARATH (Transcription factor TCP8 OS=Arabidopsis thaliana GN=TCP8 PE=2 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.188e-24
Identity = 31/41 (75.61%), Postives = 35/41 (85.37%), Query Frame = 3
Query:  159 FSVDSRTRHKSDGETIEWLLQQAEPAVIAATGTGTIPANFT 281
            F +     HKSDGETIEWLLQQAEPA++AATGTGTIPANF+
Sbjct:   85 FQLTRELGHKSDGETIEWLLQQAEPAIVAATGTGTIPANFS 125          

HSP 2 Score: 65.0846 bits (157), Expect = 1.188e-24
Identity = 30/35 (85.71%), Postives = 33/35 (94.29%), Query Frame = 1
Query:   76 RTSTKDRHTKVEGRGRRIRMPAACAARVFQLTQEL 180
            + STKDRHTKV+GRGRRIRMPA CAARVFQLT+EL
Sbjct:   57 KRSTKDRHTKVDGRGRRIRMPALCAARVFQLTREL 91          
BLAST of FC931133 vs. ExPASy Swiss-Prot
Match: PCF3_ORYSJ (Transcription factor PCF3 OS=Oryza sativa subsp. japonica GN=PCF3 PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 4.424e-24
Identity = 30/41 (73.17%), Postives = 35/41 (85.37%), Query Frame = 3
Query:  159 FSVDSRTRHKSDGETIEWLLQQAEPAVIAATGTGTIPANFT 281
            F +     HK+DGETIEWLLQQAEPA++AATGTGTIPANF+
Sbjct:  177 FQLTRELGHKTDGETIEWLLQQAEPAIVAATGTGTIPANFS 217          

HSP 2 Score: 64.3142 bits (155), Expect = 4.424e-24
Identity = 30/32 (93.75%), Postives = 31/32 (96.88%), Query Frame = 1
Query:   85 TKDRHTKVEGRGRRIRMPAACAARVFQLTQEL 180
            TKDRHTKVEGRGRRIRMPA CAARVFQLT+EL
Sbjct:  152 TKDRHTKVEGRGRRIRMPALCAARVFQLTREL 183          
BLAST of FC931133 vs. ExPASy Swiss-Prot
Match: TCP22_ARATH (Transcription factor TCP22 OS=Arabidopsis thaliana GN=TCP22 PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 7.516e-24
Identity = 31/41 (75.61%), Postives = 35/41 (85.37%), Query Frame = 3
Query:  159 FSVDSRTRHKSDGETIEWLLQQAEPAVIAATGTGTIPANFT 281
            F +     HKSDGETIEWLLQQAEPA+IA+TGTGTIPANF+
Sbjct:   88 FQLTRELGHKSDGETIEWLLQQAEPAIIASTGTGTIPANFS 128          

HSP 2 Score: 63.1586 bits (152), Expect = 7.516e-24
Identity = 29/32 (90.62%), Postives = 31/32 (96.88%), Query Frame = 1
Query:   85 TKDRHTKVEGRGRRIRMPAACAARVFQLTQEL 180
            TKDRHTKV+GRGRRIRMPA CAARVFQLT+EL
Sbjct:   63 TKDRHTKVDGRGRRIRMPAMCAARVFQLTREL 94          
BLAST of FC931133 vs. ExPASy Swiss-Prot
Match: TCP23_ARATH (Transcription factor TCP23 OS=Arabidopsis thaliana GN=TCP23 PE=1 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 2.159e-23
Identity = 31/41 (75.61%), Postives = 35/41 (85.37%), Query Frame = 3
Query:  159 FSVDSRTRHKSDGETIEWLLQQAEPAVIAATGTGTIPANFT 281
            F +    +HKSDGETIEWLLQQAEPA+IAATGTGTIPAN +
Sbjct:   80 FQLTRELQHKSDGETIEWLLQQAEPAIIAATGTGTIPANIS 120          

HSP 2 Score: 61.6178 bits (148), Expect = 2.159e-23
Identity = 28/37 (75.68%), Postives = 32/37 (86.49%), Query Frame = 1
Query:   70 PKRTSTKDRHTKVEGRGRRIRMPAACAARVFQLTQEL 180
            P +  +KDRH KV+GRGRRIRMPA CAARVFQLT+EL
Sbjct:   50 PAKRPSKDRHIKVDGRGRRIRMPAICAARVFQLTREL 86          
BLAST of FC931133 vs. ExPASy Swiss-Prot
Match: TCP19_ARATH (Transcription factor TCP19 OS=Arabidopsis thaliana GN=TCP19 PE=2 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.167e-23
Identity = 33/39 (84.62%), Postives = 36/39 (92.31%), Query Frame = 1
Query:   64 PVPKRTSTKDRHTKVEGRGRRIRMPAACAARVFQLTQEL 180
            P PKR ++KDRHTKVEGRGRRIRMPA CAARVFQLT+EL
Sbjct:   50 PAPKRPTSKDRHTKVEGRGRRIRMPAGCAARVFQLTREL 88          

HSP 2 Score: 57.7658 bits (138), Expect = 2.167e-23
Identity = 25/38 (65.79%), Postives = 30/38 (78.95%), Query Frame = 3
Query:  159 FSVDSRTRHKSDGETIEWLLQQAEPAVIAATGTGTIPA 272
            F +     HKSDGETI WLL++AEPA+I ATGTGT+PA
Sbjct:   82 FQLTRELGHKSDGETIRWLLERAEPAIIEATGTGTVPA 119          
BLAST of FC931133 vs. ExPASy Swiss-Prot
Match: TCP9_ARATH (Transcription factor TCP9 OS=Arabidopsis thaliana GN=TCP9 PE=2 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 2.807e-23
Identity = 33/39 (84.62%), Postives = 35/39 (89.74%), Query Frame = 1
Query:   64 PVPKRTSTKDRHTKVEGRGRRIRMPAACAARVFQLTQEL 180
            P  KR STKDRHTKVEGRGRRIRMPA CAAR+FQLT+EL
Sbjct:   68 PPLKRASTKDRHTKVEGRGRRIRMPATCAARIFQLTREL 106          

HSP 2 Score: 59.3066 bits (142), Expect = 2.807e-23
Identity = 26/38 (68.42%), Postives = 30/38 (78.95%), Query Frame = 3
Query:  159 FSVDSRTRHKSDGETIEWLLQQAEPAVIAATGTGTIPA 272
            F +     HKSDGETI WLL+ AEPA+IAATGTGT+PA
Sbjct:  100 FQLTRELGHKSDGETIRWLLENAEPAIIAATGTGTVPA 137          
BLAST of FC931133 vs. ExPASy Swiss-Prot
Match: PCF2_ORYSJ (Transcription factor PCF2 OS=Oryza sativa subsp. japonica GN=PCF2 PE=1 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 1.453e-21
Identity = 28/31 (90.32%), Postives = 31/31 (100.00%), Query Frame = 1
Query:   88 KDRHTKVEGRGRRIRMPAACAARVFQLTQEL 180
            +DRHTKVEGRGRRIRMPAACAAR+FQLT+EL
Sbjct:   76 RDRHTKVEGRGRRIRMPAACAARIFQLTREL 106          

HSP 2 Score: 61.2326 bits (147), Expect = 1.453e-21
Identity = 27/38 (71.05%), Postives = 31/38 (81.58%), Query Frame = 3
Query:  159 FSVDSRTRHKSDGETIEWLLQQAEPAVIAATGTGTIPA 272
            F +     HKSDGETI WLLQQ+EPA+IAATGTGT+PA
Sbjct:  100 FQLTRELGHKSDGETIRWLLQQSEPAIIAATGTGTVPA 137          
BLAST of FC931133 vs. ExPASy Swiss-Prot
Match: PCF2_ORYSI (Transcription factor PCF2 OS=Oryza sativa subsp. indica GN=PCF2 PE=4 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 1.453e-21
Identity = 28/31 (90.32%), Postives = 31/31 (100.00%), Query Frame = 1
Query:   88 KDRHTKVEGRGRRIRMPAACAARVFQLTQEL 180
            +DRHTKVEGRGRRIRMPAACAAR+FQLT+EL
Sbjct:   76 RDRHTKVEGRGRRIRMPAACAARIFQLTREL 106          

HSP 2 Score: 61.2326 bits (147), Expect = 1.453e-21
Identity = 27/38 (71.05%), Postives = 31/38 (81.58%), Query Frame = 3
Query:  159 FSVDSRTRHKSDGETIEWLLQQAEPAVIAATGTGTIPA 272
            F +     HKSDGETI WLLQQ+EPA+IAATGTGT+PA
Sbjct:  100 FQLTRELGHKSDGETIRWLLQQSEPAIIAATGTGTVPA 137          
The following BLAST results are available for this feature:
BLAST of FC931133 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 17
Match NameE-valueIdentityDescription
TCP15_ARATH4.422e-3536.57Transcription factor TCP15 OS=Arabidopsis thaliana... [more]
TCP14_ARATH7.373e-2832.02Transcription factor TCP14 OS=Arabidopsis thaliana... [more]
TCP8_ARATH1.188e-2475.61Transcription factor TCP8 OS=Arabidopsis thaliana ... [more]
PCF3_ORYSJ4.424e-2473.17Transcription factor PCF3 OS=Oryza sativa subsp. j... [more]
TCP22_ARATH7.516e-2475.61Transcription factor TCP22 OS=Arabidopsis thaliana... [more]
TCP23_ARATH2.159e-2375.61Transcription factor TCP23 OS=Arabidopsis thaliana... [more]
TCP19_ARATH2.167e-2384.62Transcription factor TCP19 OS=Arabidopsis thaliana... [more]
TCP9_ARATH2.807e-2384.62Transcription factor TCP9 OS=Arabidopsis thaliana ... [more]
PCF2_ORYSJ1.453e-2190.32Transcription factor PCF2 OS=Oryza sativa subsp. j... [more]
PCF2_ORYSI1.453e-2190.32Transcription factor PCF2 OS=Oryza sativa subsp. i... [more]

Pages

back to top
Libraries
Library NameType
PostHarvP1cdna_library
Properties
Property NameValue
Genbank descriptionC34101G12EF PostHarvP1 Citrus clementina cDNA clone C34101G12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931133 ID=FC931133|Name=FC931133|organism=Citrus clementina|type=EST|length=687bp
AACGTCAACGAACAAAGCTCAAAAGGCTTCTCTGAGTCATCCGCAGCAGC
GGCAGCAAAGAAACCTGTTCCGAAAAGAACATCAACAAAAGACAGGCACA
CGAAAGTTGAAGGGCGCGGCCGCCGGATCCGCATGCCAGCAGCTTGTGCA
GCTAGGGTTTTTCAGTTGACTCAAGAACTCGTCACAAATCTGACGGTGAA
ACCATAGAATGGTTGCTTCAACAAGCCGAGCCAGCTGTCATTGCCGCCAC
TGGCACAGGTACTATCCCTGCCAATTTCACGTCACTTAATATATCTCTTA
GGAGCTCAGGCTCAAGTATGTCGGCTACTCATTTGAGGAACACTTATTTC
AATCCAAATTTCGGTTCCCAACAATTGATGAGAAATATGAGAAGTGAATG
GGAGAGAACTCTAATTGATAATAACTGCAACTCATTGAGCTTTCCTTTAA
CTGGTGGTAATGTGAATGCTATGTTACAAAGTAATAAGCAAGAGTTACGT
GATAATAATACGATAGCTACTACTACAACGAGCTTAGATGTGTCTGAGGC
GGATACTGGTATGGGGAGAAAGCGAAGGCCAGACCAAGAATTGTCACAAA
ATAATCAGATGGGGAGTTACCTGGTTCAATCCAGCACCGGCTCTATTCCG
GCCAGTCACAGCACGATTCCGGCGACATTTTGGATGA
back to top