FC931149

Overview
NameFC931149
Unique NameFC931149
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length717
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig11368 contig Ccv1_Contig11368:107..823. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931149 vs. ExPASy Swiss-Prot
Match: HSF24_SOLPE (Heat shock factor protein HSF24 OS=Solanum peruvianum GN=HSF24 PE=2 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 1.089e-37
Identity = 70/86 (81.40%), Postives = 79/86 (91.86%), Query Frame = 3
Query:  459 MAQRSVPAPFLMKTYQLVDDPSTDDVISWNESGATFIVWKTADFAKDLLPNYFKHNNFSSFVRQLNTYGFRKIVAEQWGFANENFR 716
            M+QR+ PAPFL+KTYQLVDD +TDDVISWNE G TF+VWKTA+FAKDLLP YFKHNNFSSFVRQLNTYGFRKIV ++W FANENF+
Sbjct:    1 MSQRTAPAPFLLKTYQLVDDAATDDVISWNEIGTTFVVWKTAEFAKDLLPKYFKHNNFSSFVRQLNTYGFRKIVPDKWEFANENFK 86          
BLAST of FC931149 vs. ExPASy Swiss-Prot
Match: HSFB1_ARATH (Heat stress transcription factor B-1 OS=Arabidopsis thaliana GN=HSFB1 PE=2 SV=2)

HSP 1 Score: 151.369 bits (381), Expect = 4.577e-36
Identity = 68/85 (80.00%), Postives = 75/85 (88.24%), Query Frame = 3
Query:  462 AQRSVPAPFLMKTYQLVDDPSTDDVISWNESGATFIVWKTADFAKDLLPNYFKHNNFSSFVRQLNTYGFRKIVAEQWGFANENFR 716
            AQRSVPAPFL KTYQLVDD STDDV+SWNE G  F+VWKTA+FAKDLLP YFKHNNFSSF+RQLNTYGFRK V ++W FAN+ FR
Sbjct:    7 AQRSVPAPFLSKTYQLVDDHSTDDVVSWNEEGTAFVVWKTAEFAKDLLPQYFKHNNFSSFIRQLNTYGFRKTVPDKWEFANDYFR 91          
BLAST of FC931149 vs. ExPASy Swiss-Prot
Match: HFB2B_ORYSJ (Heat stress transcription factor B-2b OS=Oryza sativa subsp. japonica GN=HSFB2B PE=2 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 1.472e-34
Identity = 64/84 (76.19%), Postives = 75/84 (89.29%), Query Frame = 3
Query:  465 QRSVPAPFLMKTYQLVDDPSTDDVISWNESGATFIVWKTADFAKDLLPNYFKHNNFSSFVRQLNTYGFRKIVAEQWGFANENFR 716
            QR+VP PFL KTYQLVDDP+ DDVISWN+ G+TF+VW+ A+FA+DLLP YFKHNNFSSFVRQLNTYGFRKIV ++W FAN+ FR
Sbjct:   42 QRTVPTPFLTKTYQLVDDPAVDDVISWNDDGSTFVVWRPAEFARDLLPKYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANDCFR 125          
BLAST of FC931149 vs. ExPASy Swiss-Prot
Match: HFB4D_ORYSJ (Heat stress transcription factor B-4d OS=Oryza sativa subsp. japonica GN=HSFB4D PE=2 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 1.923e-34
Identity = 66/85 (77.65%), Postives = 74/85 (87.06%), Query Frame = 3
Query:  462 AQRSVPAPFLMKTYQLVDDPSTDDVISWNESGATFIVWKTADFAKDLLPNYFKHNNFSSFVRQLNTYGFRKIVAEQWGFANENFR 716
            A  + PAPFL KTYQLVDDPSTDDV+SW E  ATF+VW+  +FA+DLLPNYFKHNNFSSFVRQLNTYGFRKIVA++W FANE FR
Sbjct:   29 AVTAAPAPFLSKTYQLVDDPSTDDVVSWGEDEATFVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRKIVADRWEFANEFFR 113          
BLAST of FC931149 vs. ExPASy Swiss-Prot
Match: HFB2C_ORYSJ (Heat stress transcription factor B-2c OS=Oryza sativa subsp. japonica GN=HSFB2C PE=2 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 1.923e-34
Identity = 64/84 (76.19%), Postives = 75/84 (89.29%), Query Frame = 3
Query:  465 QRSVPAPFLMKTYQLVDDPSTDDVISWNESGATFIVWKTADFAKDLLPNYFKHNNFSSFVRQLNTYGFRKIVAEQWGFANENFR 716
            QRS+P PFL KTYQLV+DP+ DDVISWNE G+TF+VW+ A+FA+DLLP YFKHNNFSSFVRQLNTYGFRKIV ++W FAN+ FR
Sbjct:   32 QRSLPTPFLTKTYQLVEDPAVDDVISWNEDGSTFVVWRPAEFARDLLPKYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANDCFR 115          
BLAST of FC931149 vs. ExPASy Swiss-Prot
Match: HFB4B_ORYSJ (Heat stress transcription factor B-4b OS=Oryza sativa subsp. japonica GN=HSFB4B PE=2 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 3.626e-33
Identity = 63/85 (74.12%), Postives = 72/85 (84.71%), Query Frame = 3
Query:  462 AQRSVPAPFLMKTYQLVDDPSTDDVISWNESGATFIVWKTADFAKDLLPNYFKHNNFSSFVRQLNTYGFRKIVAEQWGFANENFR 716
            A + VPAPFL KTYQLVDDP TD ++SW E   TF+VW+  +FA+DLLPNYFKHNNFSSFVRQLNTYGFRKIVA++W FANE FR
Sbjct:   27 AGKPVPAPFLTKTYQLVDDPCTDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRKIVADRWEFANEFFR 111          
BLAST of FC931149 vs. ExPASy Swiss-Prot
Match: HSFB4_ARATH (Heat stress transcription factor B-4 OS=Arabidopsis thaliana GN=HSFB4 PE=2 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 8.079e-33
Identity = 65/102 (63.73%), Postives = 79/102 (77.45%), Query Frame = 3
Query:  429 GGW*GANRERMAQ------RSVPAPFLMKTYQLVDDPSTDDVISWNESGATFIVWKTADFAKDLLPNYFKHNNFSSFVRQLNTYGFRKIVAEQWGFANENFR 716
            GG+ G   ER+        ++VPAPFL KTYQLVDDP+TD V+SW +   TF+VW+  +FA+DLLPNYFKHNNFSSFVRQLNTYGFRKIV ++W FANE F+
Sbjct:   10 GGYGGGGGERIQLMVEGQGKAVPAPFLTKTYQLVDDPATDHVVSWGDDDTTFVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFK 111          
BLAST of FC931149 vs. ExPASy Swiss-Prot
Match: HFB2B_ARATH (Heat stress transcription factor B-2b OS=Arabidopsis thaliana GN=HSFB2B PE=2 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 1.378e-32
Identity = 60/85 (70.59%), Postives = 74/85 (87.06%), Query Frame = 3
Query:  462 AQRSVPAPFLMKTYQLVDDPSTDDVISWNESGATFIVWKTADFAKDLLPNYFKHNNFSSFVRQLNTYGFRKIVAEQWGFANENFR 716
            +QRS+P PFL KTYQLV+DP  D++ISWNE G TFIVW+ A+FA+DLLP YFKHNNFSSFVRQLNTYGFRK+V ++W F+N+ F+
Sbjct:   52 SQRSIPTPFLTKTYQLVEDPVYDELISWNEDGTTFIVWRPAEFARDLLPKYFKHNNFSSFVRQLNTYGFRKVVPDRWEFSNDCFK 136          
BLAST of FC931149 vs. ExPASy Swiss-Prot
Match: HFB4C_ORYSJ (Heat stress transcription factor B-4c OS=Oryza sativa subsp. japonica GN=HSFB4C PE=2 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 4.009e-32
Identity = 61/86 (70.93%), Postives = 75/86 (87.21%), Query Frame = 3
Query:  462 AQRSVPAPFLMKTYQLVDDPSTDDVISWNESG-ATFIVWKTADFAKDLLPNYFKHNNFSSFVRQLNTYGFRKIVAEQWGFANENFR 716
            AQ++VPAPFL KTYQLVDDP+TD ++SW +   +TF+VW+  +FA+D+LPNYFKHNNFSSFVRQLNTYGFRK+V E+W FANE FR
Sbjct:   17 AQKAVPAPFLTKTYQLVDDPATDHIVSWGDDRVSTFVVWRPPEFARDILPNYFKHNNFSSFVRQLNTYGFRKVVPERWEFANEFFR 102          
BLAST of FC931149 vs. ExPASy Swiss-Prot
Match: HFB2A_ARATH (Heat stress transcription factor B-2a OS=Arabidopsis thaliana GN=HSFB2A PE=2 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 1.990e-31
Identity = 59/88 (67.05%), Postives = 73/88 (82.95%), Query Frame = 3
Query:  453 ERMAQRSVPAPFLMKTYQLVDDPSTDDVISWNESGATFIVWKTADFAKDLLPNYFKHNNFSSFVRQLNTYGFRKIVAEQWGFANENFR 716
            E  +QRS+P PFL KT+ LV+D S DDVISWNE G++FIVW   DFAKDLLP +FKHNNFSSFVRQLNTYGF+K+V ++W F+N+ F+
Sbjct:   13 ESSSQRSIPTPFLTKTFNLVEDSSIDDVISWNEDGSSFIVWNPTDFAKDLLPKHFKHNNFSSFVRQLNTYGFKKVVPDRWEFSNDFFK 100          
The following BLAST results are available for this feature:
BLAST of FC931149 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 68
Match NameE-valueIdentityDescription
HSF24_SOLPE1.089e-3781.40Heat shock factor protein HSF24 OS=Solanum peruvia... [more]
HSFB1_ARATH4.577e-3680.00Heat stress transcription factor B-1 OS=Arabidopsi... [more]
HFB2B_ORYSJ1.472e-3476.19Heat stress transcription factor B-2b OS=Oryza sat... [more]
HFB4D_ORYSJ1.923e-3477.65Heat stress transcription factor B-4d OS=Oryza sat... [more]
HFB2C_ORYSJ1.923e-3476.19Heat stress transcription factor B-2c OS=Oryza sat... [more]
HFB4B_ORYSJ3.626e-3374.12Heat stress transcription factor B-4b OS=Oryza sat... [more]
HSFB4_ARATH8.079e-3363.73Heat stress transcription factor B-4 OS=Arabidopsi... [more]
HFB2B_ARATH1.378e-3270.59Heat stress transcription factor B-2b OS=Arabidops... [more]
HFB4C_ORYSJ4.009e-3270.93Heat stress transcription factor B-4c OS=Oryza sat... [more]
HFB2A_ARATH1.990e-3167.05Heat stress transcription factor B-2a OS=Arabidops... [more]

Pages

back to top
Libraries
Library NameType
PostHarvP1cdna_library
Properties
Property NameValue
Genbank descriptionC34102A05EF PostHarvP1 Citrus clementina cDNA clone C34102A05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931149 ID=FC931149|Name=FC931149|organism=Citrus clementina|type=EST|length=717bp
GTCTCTTTTATTTAATTTTTGTTTGATCGTTTATTAATTTATTTTGTTGC
GTTTCTCAAAATTTCTAGAACCCGCGTCACTTTCCTTTCCAATCTCTCTT
TATAAGAGACCCGTGCAAGAATTAACAAAGAGAACGTTTCGAATATTTTT
CAGAGAAGTTATGGTCTTTGCTCATCTAGCCGAAGGACTGGTTAGATTGG
CGATTGCTCATGGAAGCACATAGGAGCAAACGTAGTGGCAATATTTTTCT
TTCTGGGTTTTATTGCTGGGGCTGGGAATTCTTGACTGCCCTCTTGCTCT
TTAGTTGCTCCGTCTAGACCCCAAAAATATATTCATCTCACAAATTAAAG
TAGTAGGTGTTAGAGGGTTTCGAGATTTTCATTCAAGTGTAATTATTTTT
GTTTTTCTCAAAAAGGGTAGTGATTTTGGGGGGTTGGTGAGGGGCAAATC
GGGAAAGAATGGCGCAGAGGTCGGTTCCGGCGCCGTTCCTGATGAAGACG
TACCAGTTGGTGGATGATCCGAGCACTGATGATGTGATATCGTGGAATGA
AAGTGGCGCCACTTTTATTGTCTGGAAAACTGCTGATTTTGCCAAGGATC
TGCTGCCTAATTACTTCAAGCACAACAATTTTTCAAGCTTTGTCCGCCAA
CTCAATACTTATGGATTTCGGAAAATCGTGGCCGAACAATGGGGATTCGC
CAACGAGAACTTCCGTC
back to top