FC931153

Overview
NameFC931153
Unique NameFC931153
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length727
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig11773 contig Ccv1_Contig11773:396..1122. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931153 vs. ExPASy Swiss-Prot
Match: RHDF1_MOUSE (Rhomboid family member 1 OS=Mus musculus GN=Rhbdf1 PE=1 SV=2)

HSP 1 Score: 73.9442 bits (180), Expect = 9.586e-13
Identity = 43/137 (31.39%), Postives = 64/137 (46.72%), Query Frame = 2
Query:  215 DKMGALTVAKVVTQHQVWRLLTCIWLHGGVFHVLANMLSLLFIGIRLEQEFGFVRIGFLYVLSGFGGSLTSALFIQEGIXXXXXXXXXXXXXXXXXELFTNWTIYANKLAALLTLIVIISINLAVGILPKVDNFAHI 625
            D  G L         Q +RL   ++LH G+ H L ++   + +   LE+  G+ RI  +Y+LSG  G+L SA+F+                     ELF +W I A    A   L+ ++    A G+LP +DNFAHI
Sbjct:  638 DVCGLLPFLNPEVPDQFYRLWLSLFLHAGILHCLVSVCFQMTVLRDLEKLAGWHRIAIIYLLSGITGNLASAIFLPYRAEVGPAGSQFGILACLFVELFQSWQILARPWRAFFKLLAVVLFLFAFGLLPWIDNFAHI 774          
BLAST of FC931153 vs. ExPASy Swiss-Prot
Match: RHDF1_RAT (Rhomboid family member 1 OS=Rattus norvegicus GN=Rhbdf1 PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.252e-12
Identity = 43/137 (31.39%), Postives = 64/137 (46.72%), Query Frame = 2
Query:  215 DKMGALTVAKVVTQHQVWRLLTCIWLHGGVFHVLANMLSLLFIGIRLEQEFGFVRIGFLYVLSGFGGSLTSALFIQEGIXXXXXXXXXXXXXXXXXELFTNWTIYANKLAALLTLIVIISINLAVGILPKVDNFAHI 625
            D  G L         Q +RL   ++LH G+ H L ++   + +   LE+  G+ RI  +Y+LSG  G+L SA+F+                     ELF +W I A    A   L+ ++    A G+LP +DNFAHI
Sbjct:  638 DVCGLLPFLNPEVPDQFYRLWLSLFLHAGILHCLVSVCFQMTVLRDLEKLAGWHRIAIIYLLSGVTGNLASAIFLPYRAEVGPAGSQFGILACLFVELFQSWQILARPWRAFFKLLAVVLFLFAFGLLPWIDNFAHI 774          
BLAST of FC931153 vs. ExPASy Swiss-Prot
Match: RHDF1_DANRE (Rhomboid family member 1 OS=Danio rerio GN=rhbdf1 PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.252e-12
Identity = 43/137 (31.39%), Postives = 64/137 (46.72%), Query Frame = 2
Query:  215 DKMGALTVAKVVTQHQVWRLLTCIWLHGGVFHVLANMLSLLFIGIRLEQEFGFVRIGFLYVLSGFGGSLTSALFIQEGIXXXXXXXXXXXXXXXXXELFTNWTIYANKLAALLTLIVIISINLAVGILPKVDNFAHI 625
            D  G L         Q +RL   ++LH G+ H L ++   + I   LE+  G++RI  +Y+LSG  G+L SA+F+                     EL  +W I A    A   L+ ++    A G+LP +DNFAHI
Sbjct:  639 DVCGLLPFLNPEVPDQFYRLWLSLFLHAGILHCLVSVCFQMTILRDLEKLAGWLRISIIYILSGITGNLASAIFLPYRAEVGPAGSQFGILACLFVELIQSWQILAQPWRAFTKLLCVVLFLFAFGLLPWIDNFAHI 775          
BLAST of FC931153 vs. ExPASy Swiss-Prot
Match: RHDF1_BOVIN (Rhomboid family member 1 OS=Bos taurus GN=RHBDF1 PE=2 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.789e-12
Identity = 43/137 (31.39%), Postives = 63/137 (45.99%), Query Frame = 2
Query:  215 DKMGALTVAKVVTQHQVWRLLTCIWLHGGVFHVLANMLSLLFIGIRLEQEFGFVRIGFLYVLSGFGGSLTSALFIQEGIXXXXXXXXXXXXXXXXXELFTNWTIYANKLAALLTLIVIISINLAVGILPKVDNFAHI 625
            D  G L         Q +RL   ++LH GV H L ++   + +   LE+  G+ RI  +Y+LSG  G+L SA+F+                     ELF +W I A    A   L+ ++      G+LP +DNFAHI
Sbjct:  638 DVCGLLPFLNPEVPDQFYRLWLSLFLHAGVLHCLVSVCFQMTVLRDLEKLAGWHRIAIIYLLSGVTGNLASAIFLPYRAEVGPAGSQFGILACLFVELFQSWQILARPWRAFFKLLAVVLFLFTFGLLPWIDNFAHI 774          
BLAST of FC931153 vs. ExPASy Swiss-Prot
Match: RHDF1_PAPAN (Rhomboid family member 1 OS=Papio anubis GN=RHBDF1 PE=3 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 3.643e-12
Identity = 42/137 (30.66%), Postives = 63/137 (45.99%), Query Frame = 2
Query:  215 DKMGALTVAKVVTQHQVWRLLTCIWLHGGVFHVLANMLSLLFIGIRLEQEFGFVRIGFLYVLSGFGGSLTSALFIQEGIXXXXXXXXXXXXXXXXXELFTNWTIYANKLAALLTLIVIISINLAVGILPKVDNFAHI 625
            D  G L         Q +RL   ++LH G+ H L ++   + +   LE+  G+ RI  +Y+LSG  G+L SA+F+                     ELF +W I A    A   L+ ++      G+LP +DNFAHI
Sbjct:  637 DVCGLLPFLNPEVPDQFYRLWLSLFLHAGILHCLVSICFQMTVLRDLEKLAGWHRIAIIYLLSGVTGNLASAIFLPYRAEVGPAGSQFGILACLFVELFQSWQILARPWRAFFKLLAVVLFLFTFGLLPWIDNFAHI 773          
BLAST of FC931153 vs. ExPASy Swiss-Prot
Match: RHDF1_HUMAN (Rhomboid family member 1 OS=Homo sapiens GN=RHBDF1 PE=1 SV=2)

HSP 1 Score: 72.0182 bits (175), Expect = 3.643e-12
Identity = 42/137 (30.66%), Postives = 63/137 (45.99%), Query Frame = 2
Query:  215 DKMGALTVAKVVTQHQVWRLLTCIWLHGGVFHVLANMLSLLFIGIRLEQEFGFVRIGFLYVLSGFGGSLTSALFIQEGIXXXXXXXXXXXXXXXXXELFTNWTIYANKLAALLTLIVIISINLAVGILPKVDNFAHI 625
            D  G L         Q +RL   ++LH G+ H L ++   + +   LE+  G+ RI  +Y+LSG  G+L SA+F+                     ELF +W I A    A   L+ ++      G+LP +DNFAHI
Sbjct:  637 DVCGLLPFLNPEVPDQFYRLWLSLFLHAGILHCLVSICFQMTVLRDLEKLAGWHRIAIIYLLSGVTGNLASAIFLPYRAEVGPAGSQFGILACLFVELFQSWQILARPWRAFFKLLAVVLFLFTFGLLPWIDNFAHI 773          
BLAST of FC931153 vs. ExPASy Swiss-Prot
Match: RHDF1_CALMO (Rhomboid family member 1 OS=Callicebus moloch GN=RHBDF1 PE=3 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 3.643e-12
Identity = 42/137 (30.66%), Postives = 63/137 (45.99%), Query Frame = 2
Query:  215 DKMGALTVAKVVTQHQVWRLLTCIWLHGGVFHVLANMLSLLFIGIRLEQEFGFVRIGFLYVLSGFGGSLTSALFIQEGIXXXXXXXXXXXXXXXXXELFTNWTIYANKLAALLTLIVIISINLAVGILPKVDNFAHI 625
            D  G L         Q +RL   ++LH G+ H L ++   + +   LE+  G+ RI  +Y+LSG  G+L SA+F+                     ELF +W I A    A   L+ ++      G+LP +DNFAHI
Sbjct:  637 DVCGLLPFLNPEVPDQFYRLWLSLFLHAGILHCLVSICFQMTVLRDLEKLAGWHRIAIIYLLSGVTGNLASAIFLPYRAEVGPAGSQFGILACLFVELFQSWQILARPWRAFFKLLAVVLFLFTFGLLPWIDNFAHI 773          
BLAST of FC931153 vs. ExPASy Swiss-Prot
Match: RHDF1_CALJA (Rhomboid family member 1 OS=Callithrix jacchus GN=RHBDF1 PE=3 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 3.643e-12
Identity = 42/137 (30.66%), Postives = 63/137 (45.99%), Query Frame = 2
Query:  215 DKMGALTVAKVVTQHQVWRLLTCIWLHGGVFHVLANMLSLLFIGIRLEQEFGFVRIGFLYVLSGFGGSLTSALFIQEGIXXXXXXXXXXXXXXXXXELFTNWTIYANKLAALLTLIVIISINLAVGILPKVDNFAHI 625
            D  G L         Q +RL   ++LH G+ H L ++   + +   LE+  G+ RI  +Y+LSG  G+L SA+F+                     ELF +W I A    A   L+ ++      G+LP +DNFAHI
Sbjct:  637 DVCGLLPFLNPEVPDQFYRLWLSLFLHAGILHCLVSICFQMTVLRDLEKLAGWHRIAIIYLLSGVTGNLASAIFLPYRAEVGPAGSQFGILACLFVELFQSWQILARPWRAFFKLLAVVLFLFTFGLLPWIDNFAHI 773          
BLAST of FC931153 vs. ExPASy Swiss-Prot
Match: RHDF2_XENTR (Rhomboid family member 2 OS=Xenopus tropicalis GN=rhbdf2 PE=2 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 4.757e-12
Identity = 41/122 (33.61%), Postives = 61/122 (50.00%), Query Frame = 2
Query:  260 QVWRLLTCIWLHGGVFHVLANMLSLLFIGIRLEQEFGFVRIGFLYVLSGFGGSLTSALFIQEGIXXXXXXXXXXXXXXXXXELFTNWTIYANKLAALLTLIVIISINLAVGILPKVDNFAHI 625
            Q +RL   ++LH GV H   +++  + +   LE+  G++RI  +Y+LSG  G+L SALF+                     ELF +W I A    A L L+ I+      G+LP +DN AHI
Sbjct:  623 QFYRLWLSLFLHAGVIHCCVSVVFQMTVLRDLEKLAGWLRISIIYILSGITGNLASALFLPYRAEVGPAGSQFGLLACLFVELFQSWQILAKPWKAFLKLLGIVLFLFLFGLLPWIDNIAHI 744          
BLAST of FC931153 vs. ExPASy Swiss-Prot
Match: RHDF2_HUMAN (Rhomboid family member 2 OS=Homo sapiens GN=RHBDF2 PE=1 SV=2)

HSP 1 Score: 68.5514 bits (166), Expect = 4.027e-11
Identity = 44/139 (31.65%), Postives = 65/139 (46.76%), Query Frame = 2
Query:  212 LDKM-GALTVAKVVTQHQVWRLLTCIWLHGGVFHVLANMLSLLFIGIRLEQEFGFVRIGFLYVLSGFGGSLTSALFIQEGIXXXXXXXXXXXXXXXXXELFTNWTIYANKLAALLTLIVIISINLAVGILPKVDNFAHI 625
            LDK+ G L         Q +RL   ++LH GV H L +++  + I   LE+  G+ RI  +++LSG  G+L SA+F+                     ELF +W +      A L L  I+      G+LP +DN AHI
Sbjct:  636 LDKVCGLLPFLNPEVPDQFYRLWLSLFLHAGVVHCLVSVVFQMTILRDLEKLAGWHRIAIIFILSGITGNLASAIFLPYRAEVGPAGSQFGLLACLFVELFQSWPLLERPWKAFLNLSAIVLFLFICGLLPWIDNIAHI 774          
The following BLAST results are available for this feature:
BLAST of FC931153 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 11
Match NameE-valueIdentityDescription
RHDF1_MOUSE9.586e-1331.39Rhomboid family member 1 OS=Mus musculus GN=Rhbdf1... [more]
RHDF1_RAT1.252e-1231.39Rhomboid family member 1 OS=Rattus norvegicus GN=R... [more]
RHDF1_DANRE1.252e-1231.39Rhomboid family member 1 OS=Danio rerio GN=rhbdf1 ... [more]
RHDF1_BOVIN2.789e-1231.39Rhomboid family member 1 OS=Bos taurus GN=RHBDF1 P... [more]
RHDF1_PAPAN3.643e-1230.66Rhomboid family member 1 OS=Papio anubis GN=RHBDF1... [more]
RHDF1_HUMAN3.643e-1230.66Rhomboid family member 1 OS=Homo sapiens GN=RHBDF1... [more]
RHDF1_CALMO3.643e-1230.66Rhomboid family member 1 OS=Callicebus moloch GN=R... [more]
RHDF1_CALJA3.643e-1230.66Rhomboid family member 1 OS=Callithrix jacchus GN=... [more]
RHDF2_XENTR4.757e-1233.61Rhomboid family member 2 OS=Xenopus tropicalis GN=... [more]
RHDF2_HUMAN4.027e-1131.65Rhomboid family member 2 OS=Homo sapiens GN=RHBDF2... [more]

Pages

back to top
Libraries
Library NameType
PostHarvP1cdna_library
Properties
Property NameValue
Genbank descriptionC34102A09EF PostHarvP1 Citrus clementina cDNA clone C34102A09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931153 ID=FC931153|Name=FC931153|organism=Citrus clementina|type=EST|length=727bp
GTACAGTGATTTTTTGAGCCCGCTTAAACGGCATTTCCCGTGGATGGTCC
CGGGTTTCGTCGTAGCCAACATTGTTTTGTTTGTTATCACAATGTACGAA
AATAATTGCCCTCAAACTTCTGCTACTGGTTGTTTGGGTGCCAAATTTTT
GGGTAGATTTTCATTTTTGCCCCTGAAAGACAATCCCCTCCTCGGCCCTT
CCTCTCCCGCGTTAGACAAGATGGGTGCTTTAACAGTAGCCAAGGTGGTA
ACTCAACACCAAGTGTGGCGTTTGTTGACTTGTATATGGTTGCATGGTGG
GGTTTTCCATGTACTTGCCAATATGTTGAGTCTACTATTCATTGGAATTC
GGCTTGAACAAGAATTTGGATTTGTTCGAATTGGATTCCTCTACGTCCTC
TCTGGTTTTGGTGGGAGTTTGACGTCGGCTCTTTTTATTCAAGAGGGTAT
ATCTGTCGGTGCCTCTGGAGCTCTTTTTGGTTTACTTGGAGCAATGCTCT
CGGAGCTTTTCACAAATTGGACTATCTATGCAAATAAGTTGGCAGCATTG
CTTACTCTCATTGTCATCATCAGTATAAATTTGGCAGTGGGAATCCTCCC
AAAAGTGGACAACTTTGCTCATATTGGAGGATTTCTTTCTGGTTTTCTTC
TTGGATTTGTGCTTCTAATCCGGCCTCAGTTTGGATGGATTAGTCAGAAA
AAGCTCCCCCTGGATACATGATAAATT
back to top