FC931159

Overview
NameFC931159
Unique NameFC931159
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length709
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15352 contig Ccv1_Contig15352:174..881. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931159 vs. ExPASy Swiss-Prot
Match: THIC1_ARATH (Acetyl-CoA acetyltransferase, cytosolic 1 OS=Arabidopsis thaliana GN=AAT1 PE=2 SV=1)

HSP 1 Score: 424.091 bits (1089), Expect = 3.644e-118
Identity = 209/236 (88.56%), Postives = 223/236 (94.49%), Query Frame = 2
Query:    2 PMGGFLGTLSSLSATKLGSIAIEAALKRANVDPSLVQEVFFGNVLSANLGQAPARQAALGAGIPNSVVCTTVNKVCASGLKAIMLASQSIQLGINDVIVAGGMESMSNAPKYLAEARKGSRLGHDSLVDGMLKDGLWDVYNDCSMGTCAELCAEQHSITRENQDDFAVLSFERGIAAQDAGAFAWEIVPVEVSAGRGKPSTIVDKDEGLGKFDPAKLRKLRPSFKENGGTVTAGNA 709
            PMGGFLG+LSSL ATKLGS+AI AALKRANVDP+LVQEV FGNVLSANLGQAPARQAALGAGIPNSV+CTTVNKVCASG+KA+M+A+QSIQLGINDV+VAGGMESMSN PKYLAEARKGSR GHDSLVDGMLKDGLWDVYNDC MG+CAELCAE+  ITRE QDD+AV SFERGIAAQ+AGAF WEIVPVEVS GRG+PSTIVDKDEGLGKFD AKLRKLRPSFKENGGTVTAGNA
Sbjct:   22 PMGGFLGSLSSLPATKLGSLAIAAALKRANVDPALVQEVVFGNVLSANLGQAPARQAALGAGIPNSVICTTVNKVCASGMKAVMIAAQSIQLGINDVVVAGGMESMSNTPKYLAEARKGSRFGHDSLVDGMLKDGLWDVYNDCGMGSCAELCAEKFQITREQQDDYAVQSFERGIAAQEAGAFTWEIVPVEVSGGRGRPSTIVDKDEGLGKFDAAKLRKLRPSFKENGGTVTAGNA 257          
BLAST of FC931159 vs. ExPASy Swiss-Prot
Match: THIC2_ARATH (Probable acetyl-CoA acetyltransferase, cytosolic 2 OS=Arabidopsis thaliana GN=At5g47720 PE=2 SV=1)

HSP 1 Score: 387.111 bits (993), Expect = 4.936e-107
Identity = 183/236 (77.54%), Postives = 218/236 (92.37%), Query Frame = 2
Query:    2 PMGGFLGTLSSLSATKLGSIAIEAALKRANVDPSLVQEVFFGNVLSANLGQAPARQAALGAGIPNSVVCTTVNKVCASGLKAIMLASQSIQLGINDVIVAGGMESMSNAPKYLAEARKGSRLGHDSLVDGMLKDGLWDVYNDCSMGTCAELCAEQHSITRENQDDFAVLSFERGIAAQDAGAFAWEIVPVEVSAGRGKPSTIVDKDEGLGKFDPAKLRKLRPSFKENGGTVTAGNA 709
            P+G FLG+LSSL+AT+LGSIAI+AALKRA+VDP+LV+EVFFGNVL+ANLGQAPARQAALGAGIP SV+CTT+NKVCA+G+K++MLASQSIQLG+ND++VAGGMESMSN PKYL +AR+GSRLGHD++VDGM+KDGLWDVYND  MG C E+CA+Q+ ITRE QD +A+ SFERGIAAQ+   FAWEIVPVEVS GRG+PS ++DKDEGLGKFD AKL+KLRPSFKE+GG+VTAGNA
Sbjct:   24 PIGDFLGSLSSLTATRLGSIAIQAALKRAHVDPALVEEVFFGNVLTANLGQAPARQAALGAGIPYSVICTTINKVCAAGMKSVMLASQSIQLGLNDIVVAGGMESMSNVPKYLPDARRGSRLGHDTVVDGMMKDGLWDVYNDFGMGVCGEICADQYRITREEQDAYAIQSFERGIAAQNTQLFAWEIVPVEVSTGRGRPSVVIDKDEGLGKFDAAKLKKLRPSFKEDGGSVTAGNA 259          
BLAST of FC931159 vs. ExPASy Swiss-Prot
Match: THIL_SCHPO (Acetyl-CoA acetyltransferase OS=Schizosaccharomyces pombe GN=erg10 PE=2 SV=1)

HSP 1 Score: 265.003 bits (676), Expect = 2.829e-70
Identity = 139/236 (58.90%), Postives = 172/236 (72.88%), Query Frame = 2
Query:    2 PMGGFLGTLSSLSATKLGSIAIEAALKRANVDPSLVQEVFFGNVLSANLGQAPARQAALGAGIPNSVVCTTVNKVCASGLKAIMLASQSIQLGINDVIVAGGMESMSNAPKYLAEARKGSRLGHDSLVDGMLKDGLWDVYNDCSMGTCAELCAEQHSITRENQDDFAVLSFERGIAAQDAGAFAWEIVPVEVSAGRGKPSTIVDKDEGLGKFDPAKLRKLRPSFKENGGTVTAGNA 709
            PMG F G+ +SL ATKLGSIAI+ AL+R N+ PS V EVF GNV+SANLGQ PARQ ALGAG+P S+VCTTVNKVCASG+KA +L +Q+I  G  +++VAGG ESMSNAP Y  + R G++ G+  LVDG+L+DGL D Y+   MG  AELCAE+HSI R +QD FA+ S++R   AQ   AF  EIVPVEV  GRGKP+ +V +DE     +  KL+ +R  FK N GTVTA NA
Sbjct:   15 PMGSFGGSFASLPATKLGSIAIKGALERVNIKPSDVDEVFMGNVVSANLGQNPARQCALGAGLPRSIVCTTVNKVCASGMKATILGAQTIMTGNAEIVVAGGTESMSNAPYYAPKNRFGAKYGNVELVDGLLRDGLSDAYDGLPMGNAAELCAEEHSIDRASQDAFAISSYKRAQNAQATKAFEQEIVPVEVPVGRGKPNKLVTEDEEPKNLNEDKLKSVRAVFKSN-GTVTAANA 249          
BLAST of FC931159 vs. ExPASy Swiss-Prot
Match: THIA_CANTR (Acetyl-CoA acetyltransferase IA OS=Candida tropicalis GN=PACTA PE=1 SV=3)

HSP 1 Score: 239.195 bits (609), Expect = 1.662e-62
Identity = 118/237 (49.79%), Postives = 165/237 (69.62%), Query Frame = 2
Query:    2 PMGGFLGTLSSLSATKLGSIAIEAALKRA-NVDPSLVQEVFFGNVLSANLGQAPARQAALGAGIPNSVVCTTVNKVCASGLKAIMLASQSIQLGINDVIVAGGMESMSNAPKYLAEARKGSRLGHDSLVDGMLKDGLWDVYNDCSMGTCAELCAEQHSITRENQDDFAVLSFERGIAAQDAGAFAWEIVPVEVSAGRGKPSTIVDKDEGLGKFDPAKLRKLRPSFKENGGTVTAGNA 709
            P+G F G+LSSL+ + LG+ A++AAL +   + P  V E+ FG VL AN+GQAPARQ AL AG+P+S+V +T+NKVCASG+KA+++ +Q+I  G +D++V GG ESMSN P YL  AR G+R G   +VDG+ KDGL DVY +  MG  AE CA+ H  +RE+QD+FA+ S+++   A   G F  EI PV +   RGKP T+++ DE +GKF+  +L+  R  F++  GTVTA NA
Sbjct:   15 PIGSFQGSLSSLTYSDLGAHAVKAALAKVPQIKPQDVDEIVFGGVLQANVGQAPARQVALKAGLPDSIVASTINKVCASGMKAVIIGAQNIICGTSDIVVVGGAESMSNTPYYLPSARSGARYGDAIMVDGVQKDGLLDVYEEKLMGVAAEKCAKDHGFSREDQDNFAINSYKKAGKALSEGKFKSEIAPVTIKGFRGKPDTVIENDEEIGKFNEERLKSARTVFQKENGTVTAPNA 251          
BLAST of FC931159 vs. ExPASy Swiss-Prot
Match: THIB_CANTR (Acetyl-CoA acetyltransferase IB OS=Candida tropicalis GN=PACTB PE=1 SV=3)

HSP 1 Score: 238.424 bits (607), Expect = 2.836e-62
Identity = 117/237 (49.37%), Postives = 165/237 (69.62%), Query Frame = 2
Query:    2 PMGGFLGTLSSLSATKLGSIAIEAALKRA-NVDPSLVQEVFFGNVLSANLGQAPARQAALGAGIPNSVVCTTVNKVCASGLKAIMLASQSIQLGINDVIVAGGMESMSNAPKYLAEARKGSRLGHDSLVDGMLKDGLWDVYNDCSMGTCAELCAEQHSITRENQDDFAVLSFERGIAAQDAGAFAWEIVPVEVSAGRGKPSTIVDKDEGLGKFDPAKLRKLRPSFKENGGTVTAGNA 709
            P+G F G+LSSL+ + LG+ A++AAL +   + P  V E+ FG VL AN+GQAPARQ AL AG+P+S++ +T+NKVCASG+KA+++ +Q+I  G +D++V GG ESMSN P YL  AR G+R G   +VDG+ KDGL DVY +  MG  AE CA+ H  +RE+QD+FA+ S+++   A   G F  EI PV +   RGKP T+++ DE +GKF+  +L+  R  F++  GTVTA NA
Sbjct:   15 PIGSFQGSLSSLTYSDLGAHAVKAALAKVPQIKPQDVDEIVFGGVLQANVGQAPARQVALKAGLPDSIIASTINKVCASGMKAVIIGAQNIICGTSDIVVVGGAESMSNTPYYLPSARSGARYGDAVMVDGVQKDGLLDVYEEKLMGVAAEKCAKDHGFSREDQDNFAINSYKKAGKALSEGKFKSEIAPVTIKGFRGKPDTVIENDEEIGKFNEDRLKSARTVFQKENGTVTAPNA 251          
BLAST of FC931159 vs. ExPASy Swiss-Prot
Match: THIL_BOVIN (Acetyl-CoA acetyltransferase, mitochondrial OS=Bos taurus GN=ACAT1 PE=2 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 7.722e-60
Identity = 124/236 (52.54%), Postives = 162/236 (68.64%), Query Frame = 2
Query:    2 PMGGFLGTLSSLSATKLGSIAIEAALKRANVDPSLVQEVFFGNVLSANLGQAPARQAALGAGIPNSVVCTTVNKVCASGLKAIMLASQSIQLGINDVIVAGGMESMSNAPKYLAEARKGSRLGHDSLVDGMLKDGLWDVYNDCSMGTCAELCAEQHSITRENQDDFAVLSFERGIAAQDAGAFAWEIVPVEVSAGRGKPSTIVDKDEGLGKFDPAKLRKLRPSFKENGGTVTAGNA 709
            P+G FLG+LSSL ATKLGSIAI+ A+++A +    V+E + GNVL    GQAP RQA LGAG+P S  CTT+NKVCASG+KAIM+ASQ++  G  DV+VAGGMESMSN P  +   R  +  G   L D ++KDGL DVYN   MG CAE  A++ +ITRE QD +A+ S+ R  AA +AG F  E+VPV ++  +GKP  +V +DE   + D +K+ KL+  F+   GTVTA NA
Sbjct:   46 PIGSFLGSLSSLPATKLGSIAIQGAIEKAGIPKEEVKEAYMGNVLQGGEGQAPTRQAVLGAGLPISTPCTTINKVCASGMKAIMMASQNLMCGHQDVMVAGGMESMSNVPYVM--NRGATPYGGVKLEDLIVKDGLTDVYNKIHMGNCAENTAKKLNITREEQDTYALNSYTRSKAAWEAGRFGNEVVPVTITV-KGKPDVVVKEDEEYKRVDFSKIPKLKTVFQRENGTVTAANA 278          
BLAST of FC931159 vs. ExPASy Swiss-Prot
Match: THIL_YEAST (Acetyl-CoA acetyltransferase OS=Saccharomyces cerevisiae GN=ERG10 PE=1 SV=3)

HSP 1 Score: 229.565 bits (584), Expect = 1.317e-59
Identity = 124/238 (52.10%), Postives = 161/238 (67.65%), Query Frame = 2
Query:    2 PMGGFLGTLSSLSATKLGSIAIEAALKRA-NVDPSL-VQEVFFGNVLSANLGQAPARQAALGAGIPNSVVCTTVNKVCASGLKAIMLASQSIQLGINDVIVAGGMESMSNAPKYLAEARKGSRLGHDSLVDGMLKDGLWDVYNDCSMGTCAELCAEQHSITRENQDDFAVLSFERGIAAQDAGAFAWEIVPVEVSAGRGKPSTIVDKDEGLGKFDPAKLRKLRPSFKENGGTVTAGNA 709
            P+G F G+LSS +A +LG++A++ AL +   +D S    E+ FGNVLSANLGQAPARQ AL AG+ N +V +TVNKVCAS +KAI+L +QSI+ G  DV+VAGG ESM+NAP Y+  AR G++ G   LVDG+ +DGL D Y+  +MG  AE CA    ITRE QD+FA+ S+++   +Q  G F  EIVPV +   RGKP T V KDE   +    KLR  R  F++  GTVTA NA
Sbjct:   14 PIGSFQGSLSSKTAVELGAVALKGALAKVPELDASKDFDEIIFGNVLSANLGQAPARQVALAAGLSNHIVASTVNKVCASAMKAIILGAQSIKCGNADVVVAGGCESMTNAPYYMPAARAGAKFGQTVLVDGVERDGLNDAYDGLAMGVHAEKCARDWDITREQQDNFAIESYQKSQKSQKEGKFDNEIVPVTIKGFRGKPDTQVTKDEEPARLHVEKLRSARTVFQKENGTVTAANA 251          
BLAST of FC931159 vs. ExPASy Swiss-Prot
Match: THIL_RAT (Acetyl-CoA acetyltransferase, mitochondrial OS=Rattus norvegicus GN=Acat1 PE=1 SV=1)

HSP 1 Score: 228.794 bits (582), Expect = 2.247e-59
Identity = 123/236 (52.12%), Postives = 163/236 (69.07%), Query Frame = 2
Query:    2 PMGGFLGTLSSLSATKLGSIAIEAALKRANVDPSLVQEVFFGNVLSANLGQAPARQAALGAGIPNSVVCTTVNKVCASGLKAIMLASQSIQLGINDVIVAGGMESMSNAPKYLAEARKGSRLGHDSLVDGMLKDGLWDVYNDCSMGTCAELCAEQHSITRENQDDFAVLSFERGIAAQDAGAFAWEIVPVEVSAGRGKPSTIVDKDEGLGKFDPAKLRKLRPSFKENGGTVTAGNA 709
            P+G FLG+L+S  ATKLG+IAI+ A+++A +    V+EV+ GNV+    GQAP RQA LGAG+P +  CTTVNKVCASG+KAIM+ASQS+  G  DV+VAGGMESMSN P  +  +R  +  G   L D ++KDGL DVYN   MG CAE  A++ SI+RE QD +A+ S+ R   A DAG FA EI P+ +S  +GKP  +V +DE   + D +K+ KL+  F++  GTVTA NA
Sbjct:   48 PIGSFLGSLASQPATKLGTIAIQGAIEKAGIPKEEVKEVYMGNVIQGGEGQAPTRQATLGAGLPIATPCTTVNKVCASGMKAIMMASQSLMCGHQDVMVAGGMESMSNVPYVM--SRGATPYGGVKLEDLIVKDGLTDVYNKIHMGNCAENTAKKLSISREEQDKYAIGSYTRSKEAWDAGKFANEITPITISV-KGKPDVVVKEDEEYKRVDFSKVPKLKTVFQKENGTVTAANA 280          
BLAST of FC931159 vs. ExPASy Swiss-Prot
Match: THILA_XENLA (Acetyl-CoA acetyltransferase A, mitochondrial OS=Xenopus laevis GN=acat1-A PE=2 SV=1)

HSP 1 Score: 226.868 bits (577), Expect = 8.538e-59
Identity = 126/236 (53.39%), Postives = 163/236 (69.07%), Query Frame = 2
Query:    2 PMGGFLGTLSSLSATKLGSIAIEAALKRANVDPSLVQEVFFGNVLSANLGQAPARQAALGAGIPNSVVCTTVNKVCASGLKAIMLASQSIQLGINDVIVAGGMESMSNAPKYLAEARKGSRLGHDSLVDGMLKDGLWDVYNDCSMGTCAELCAEQHSITRENQDDFAVLSFERGIAAQDAGAFAWEIVPVEVSAGRGKPSTIVDKDEGLGKFDPAKLRKLRPSFKENGGTVTAGNA 709
            P+G F GTLSSL ATKLGSIAI+AA++RA +    V+EV+ GNVL A  GQAP+RQA LGAG+  S   TT+NKVCASG+K++MLA+QS+  G   V+VAGGMESMSN P  +  +R  +  G   L D ++KDGL DVYN   MG CAE  A++ SI+RE QD FA+ S+ R  AA D+G  A EI PV + A +GKP  IV +DE   + D +K  KL+  F+++ GTVTA N+
Sbjct:   44 PIGSFQGTLSSLPATKLGSIAIKAAVERAGIPADEVKEVYMGNVLQAGQGQAPSRQATLGAGLAISTPTTTINKVCASGMKSVMLAAQSLMCGHQQVMVAGGMESMSNVPYCM--SRGATPYGGVKLEDLIVKDGLTDVYNKIHMGNCAENTAKKFSISREEQDSFAIHSYTRSKAAWDSGLIANEIAPVTI-AQKGKPDIIVQEDEEYKRVDFSKFPKLKTVFQKDNGTVTAANS 276          
BLAST of FC931159 vs. ExPASy Swiss-Prot
Match: THIL_MOUSE (Acetyl-CoA acetyltransferase, mitochondrial OS=Mus musculus GN=Acat1 PE=1 SV=1)

HSP 1 Score: 226.098 bits (575), Expect = 1.456e-58
Identity = 120/236 (50.85%), Postives = 162/236 (68.64%), Query Frame = 2
Query:    2 PMGGFLGTLSSLSATKLGSIAIEAALKRANVDPSLVQEVFFGNVLSANLGQAPARQAALGAGIPNSVVCTTVNKVCASGLKAIMLASQSIQLGINDVIVAGGMESMSNAPKYLAEARKGSRLGHDSLVDGMLKDGLWDVYNDCSMGTCAELCAEQHSITRENQDDFAVLSFERGIAAQDAGAFAWEIVPVEVSAGRGKPSTIVDKDEGLGKFDPAKLRKLRPSFKENGGTVTAGNA 709
            P+G FLG+L+S  ATKLG+ AI+ A+++A +    V+EV+ GNV+    GQAP RQA LGAG+P S  CTTVNKVCASG+KAIM+ASQS+  G  DV+VAGGMESMSN P  +  +R  +  G   L D ++KDGL DVYN   MG CAE  A++ +I+R+ QD +A+ S+ R   A DAG FA EI P+ +S  +GKP  +V +DE   + D +K+ KL+  F++  GT+TA NA
Sbjct:   48 PIGSFLGSLASQPATKLGTAAIQGAIEKAGIPKEEVKEVYMGNVIQGGEGQAPTRQATLGAGLPISTPCTTVNKVCASGMKAIMMASQSLMCGHQDVMVAGGMESMSNVPYVM--SRGATPYGGVKLEDLIVKDGLTDVYNKIHMGNCAENTAKKMNISRQEQDTYALSSYTRSKEAWDAGKFASEITPITISV-KGKPDVVVKEDEEYKRVDFSKVPKLKTVFQKENGTITAANA 280          
The following BLAST results are available for this feature:
BLAST of FC931159 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 280
Match NameE-valueIdentityDescription
THIC1_ARATH3.644e-11888.56Acetyl-CoA acetyltransferase, cytosolic 1 OS=Arabi... [more]
THIC2_ARATH4.936e-10777.54Probable acetyl-CoA acetyltransferase, cytosolic 2... [more]
THIL_SCHPO2.829e-7058.90Acetyl-CoA acetyltransferase OS=Schizosaccharomyce... [more]
THIA_CANTR1.662e-6249.79Acetyl-CoA acetyltransferase IA OS=Candida tropica... [more]
THIB_CANTR2.836e-6249.37Acetyl-CoA acetyltransferase IB OS=Candida tropica... [more]
THIL_BOVIN7.722e-6052.54Acetyl-CoA acetyltransferase, mitochondrial OS=Bos... [more]
THIL_YEAST1.317e-5952.10Acetyl-CoA acetyltransferase OS=Saccharomyces cere... [more]
THIL_RAT2.247e-5952.12Acetyl-CoA acetyltransferase, mitochondrial OS=Rat... [more]
THILA_XENLA8.538e-5953.39Acetyl-CoA acetyltransferase A, mitochondrial OS=X... [more]
THIL_MOUSE1.456e-5850.85Acetyl-CoA acetyltransferase, mitochondrial OS=Mus... [more]

Pages

back to top
Libraries
Library NameType
PostHarvP1cdna_library
Properties
Property NameValue
Genbank descriptionC34102B03EF PostHarvP1 Citrus clementina cDNA clone C34102B03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931159 ID=FC931159|Name=FC931159|organism=Citrus clementina|type=EST|length=709bp
ACCAATGGGTGGATTTCTTGGTACTCTATCTTCCTTATCTGCTACCAAGC
TTGGATCTATCGCTATTGAAGCTGCTCTTAAGAGAGCAAATGTTGATCCA
TCACTTGTACAAGAAGTTTTCTTTGGTAATGTTCTCAGTGCAAATCTAGG
ACAGGCTCCTGCTAGACAGGCTGCATTGGGTGCAGGAATTCCGAATTCAG
TGGTCTGTACTACTGTTAACAAAGTTTGTGCATCAGGGCTGAAAGCTATA
ATGCTTGCATCACAGAGTATCCAGTTGGGGATCAATGATGTCATTGTGGC
TGGAGGAATGGAAAGCATGTCTAACGCACCTAAATATTTGGCAGAAGCGA
GAAAGGGGTCTCGACTTGGACATGATTCTCTGGTTGATGGAATGCTTAAA
GATGGATTATGGGATGTTTATAATGATTGTAGCATGGGAACTTGTGCTGA
ACTTTGTGCTGAACAACATTCAATAACAAGGGAGAATCAGGATGACTTTG
CTGTTCTGAGCTTTGAGCGTGGTATTGCTGCCCAAGATGCTGGTGCCTTT
GCATGGGAAATTGTTCCAGTTGAAGTTTCTGCGGGAAGGGGAAAACCATC
AACCATTGTTGATAAGGATGAAGGTTTAGGCAAGTTTGACCCGGCAAAAT
TGAGGAAGCTTCGACCAAGTTTCAAGGAGAATGGAGGAACTGTTACGGCT
GGCAATGCC
back to top