FC931234

Overview
NameFC931234
Unique NameFC931234
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length720
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig369 contig Ccv1_Contig369:1..710. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931234 vs. ExPASy Swiss-Prot
Match: RLA0_SOYBN (60S acidic ribosomal protein P0 OS=Glycine max PE=2 SV=1)

HSP 1 Score: 243.047 bits (619), Expect = 9.721e-73
Identity = 123/152 (80.92%), Postives = 131/152 (86.18%), Query Frame = 2
Query:  188 MVVKASKAEKKIAYDAKLCQLLEEYTQILVAAADNVGSNQLQNIRRGLRGDSVVLMGKNTMMKRTIRMHAEKTGNTAFLNLIPLLQGNVGLIFTKGDLXXXXXXXXXXXXGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINR 643
            M  K +KAEKKIAYDAKLC L+EEY QILV  +DNVGSNQLQNIR+GLRGDSVVLMGKNTMMKR++RMHAEKTGN A+LNLIPLL GNVGLIFTKGDL            GAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKIN+
Sbjct:    1 MAPKQTKAEKKIAYDAKLCDLMEEYGQILVVNSDNVGSNQLQNIRKGLRGDSVVLMGKNTMMKRSVRMHAEKTGNNAYLNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINK 152          

HSP 2 Score: 52.373 bits (124), Expect = 9.721e-73
Identity = 26/27 (96.30%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  640 QGTVEIITPVELIRKGDKVGSSEAALL 720
            +GTVEIITPVELIRKGDKVGSSEAALL
Sbjct:  152 KGTVEIITPVELIRKGDKVGSSEAALL 178          
BLAST of FC931234 vs. ExPASy Swiss-Prot
Match: RLA01_ARATH (60S acidic ribosomal protein P0-1 OS=Arabidopsis thaliana GN=RPP0A PE=2 SV=1)

HSP 1 Score: 242.662 bits (618), Expect = 2.813e-72
Identity = 122/152 (80.26%), Postives = 133/152 (87.50%), Query Frame = 2
Query:  188 MVVKASKAEKKIAYDAKLCQLLEEYTQILVAAADNVGSNQLQNIRRGLRGDSVVLMGKNTMMKRTIRMHAEKTGNTAFLNLIPLLQGNVGLIFTKGDLXXXXXXXXXXXXGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINR 643
            M VKA+KAEKKI YD+KLCQLL EY+QILV AADNVGS QLQNIR+GLRGDSVVLMGKNTMMKR++R+HA+KTGN AFL+L+PLLQGNVGLIFTKGDL            GAPARVGLVAPIDVVV PGNTGLDPSQTSFFQVLNIPTKIN+
Sbjct:    1 MAVKATKAEKKIVYDSKLCQLLNEYSQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMMKRSVRIHADKTGNQAFLSLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINK 152          

HSP 2 Score: 51.2174 bits (121), Expect = 2.813e-72
Identity = 25/27 (92.59%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  640 QGTVEIITPVELIRKGDKVGSSEAALL 720
            +GTVEIITPVELI+KGDKVGSSEAALL
Sbjct:  152 KGTVEIITPVELIKKGDKVGSSEAALL 178          
BLAST of FC931234 vs. ExPASy Swiss-Prot
Match: RLA02_ARATH (60S acidic ribosomal protein P0-2 OS=Arabidopsis thaliana GN=RPP0B PE=1 SV=2)

HSP 1 Score: 243.817 bits (621), Expect = 3.668e-72
Identity = 122/151 (80.79%), Postives = 133/151 (88.08%), Query Frame = 2
Query:  191 VVKASKAEKKIAYDAKLCQLLEEYTQILVAAADNVGSNQLQNIRRGLRGDSVVLMGKNTMMKRTIRMHAEKTGNTAFLNLIPLLQGNVGLIFTKGDLXXXXXXXXXXXXGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINR 643
            +VKA+KAEKKIAYD KLCQL++EYTQILV AADNVGS QLQNIR+GLRGDSVVLMGKNTMMKR++R+H+E TGNTA LNL+PLLQGNVGLIFTKGDL            GAPARVGLVAPIDVVV PGNTGLDPSQTSFFQVLNIPTKIN+
Sbjct:    1 MVKATKAEKKIAYDTKLCQLIDEYTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMMKRSVRIHSENTGNTAILNLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINK 151          

HSP 2 Score: 49.6766 bits (117), Expect = 3.668e-72
Identity = 24/27 (88.89%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  640 QGTVEIITPVELIRKGDKVGSSEAALL 720
            +GTVEIITPVELI++GDKVGSSEAALL
Sbjct:  151 KGTVEIITPVELIKQGDKVGSSEAALL 177          
BLAST of FC931234 vs. ExPASy Swiss-Prot
Match: RLA03_ARATH (60S acidic ribosomal protein P0-3 OS=Arabidopsis thaliana GN=RPP0C PE=1 SV=1)

HSP 1 Score: 242.276 bits (617), Expect = 1.061e-71
Identity = 121/151 (80.13%), Postives = 133/151 (88.08%), Query Frame = 2
Query:  191 VVKASKAEKKIAYDAKLCQLLEEYTQILVAAADNVGSNQLQNIRRGLRGDSVVLMGKNTMMKRTIRMHAEKTGNTAFLNLIPLLQGNVGLIFTKGDLXXXXXXXXXXXXGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINR 643
            +VKA+KAEKKIAYD KLCQL++EYTQILV AADNVGS QLQNIR+GLRGDSVVLMGKNTMMKR++R+H+E +GNTA LNL+PLLQGNVGLIFTKGDL            GAPARVGLVAPIDVVV PGNTGLDPSQTSFFQVLNIPTKIN+
Sbjct:    1 MVKATKAEKKIAYDTKLCQLIDEYTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMMKRSVRIHSENSGNTAILNLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINK 151          

HSP 2 Score: 49.6766 bits (117), Expect = 1.061e-71
Identity = 24/27 (88.89%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  640 QGTVEIITPVELIRKGDKVGSSEAALL 720
            +GTVEIITPVELI++GDKVGSSEAALL
Sbjct:  151 KGTVEIITPVELIKQGDKVGSSEAALL 177          
BLAST of FC931234 vs. ExPASy Swiss-Prot
Match: RLA0_LUPLU (60S acidic ribosomal protein P0 OS=Lupinus luteus PE=2 SV=1)

HSP 1 Score: 236.884 bits (603), Expect = 1.510e-70
Identity = 122/152 (80.26%), Postives = 129/152 (84.87%), Query Frame = 2
Query:  188 MVVKASKAEKKIAYDAKLCQLLEEYTQILVAAADNVGSNQLQNIRRGLRGDSVVLMGKNTMMKRTIRMHAEKTGNTAFLNLIPLLQGNVGLIFTKGDLXXXXXXXXXXXXGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINR 643
            M  KA+KAEKKI YD KLCQLL+EYTQILV  ADNVGS QLQNIR+GLRGDSVVLMGKNTMMKR++R+HAEKTGN AFLNLIPLL GNVGLIFTKG L            GAPA VGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKIN+
Sbjct:    1 MAPKATKAEKKIVYDGKLCQLLDEYTQILVVNADNVGSKQLQNIRQGLRGDSVVLMGKNTMMKRSVRIHAEKTGNQAFLNLIPLLIGNVGLIFTKGYLKEVSEEVAKYKVGAPACVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINK 152          

HSP 2 Score: 51.2174 bits (121), Expect = 1.510e-70
Identity = 25/27 (92.59%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  640 QGTVEIITPVELIRKGDKVGSSEAALL 720
            +GTVEIITPVELI+KGDKVGSSEAALL
Sbjct:  152 KGTVEIITPVELIKKGDKVGSSEAALL 178          
BLAST of FC931234 vs. ExPASy Swiss-Prot
Match: RLA0_ORYSJ (60S acidic ribosomal protein P0 OS=Oryza sativa subsp. japonica GN=Os08g0130500 PE=1 SV=3)

HSP 1 Score: 230.335 bits (586), Expect = 3.056e-68
Identity = 111/152 (73.03%), Postives = 129/152 (84.87%), Query Frame = 2
Query:  188 MVVKASKAEKKIAYDAKLCQLLEEYTQILVAAADNVGSNQLQNIRRGLRGDSVVLMGKNTMMKRTIRMHAEKTGNTAFLNLIPLLQGNVGLIFTKGDLXXXXXXXXXXXXGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINR 643
            M +K +KAEKK+AYD KLCQLL+EYT++L+A ADNVGSNQLQ IR+GLRGDS+VLMGKNT+++R I++HA+ TGN  FL L+PLL GNVGLIFTKGDL            GAPARVGLVAP+DVVVPPGNTGLDPSQTSFFQVLNIPTKIN+
Sbjct:    1 MAIKRTKAEKKVAYDKKLCQLLDEYTKVLIAVADNVGSNQLQEIRKGLRGDSIVLMGKNTLIRRCIKVHADNTGNKEFLELMPLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVAPVDVVVPPGNTGLDPSQTSFFQVLNIPTKINK 152          

HSP 2 Score: 50.0618 bits (118), Expect = 3.056e-68
Identity = 24/27 (88.89%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  640 QGTVEIITPVELIRKGDKVGSSEAALL 720
            +GTVEIITPVELI+KGDKVGSSE+ALL
Sbjct:  152 KGTVEIITPVELIKKGDKVGSSESALL 178          
BLAST of FC931234 vs. ExPASy Swiss-Prot
Match: RLA0_MAIZE (60S acidic ribosomal protein P0 OS=Zea mays GN=RP-P0 PE=1 SV=3)

HSP 1 Score: 221.861 bits (564), Expect = 3.038e-65
Identity = 111/152 (73.03%), Postives = 127/152 (83.55%), Query Frame = 2
Query:  188 MVVKASKAEKKIAYDAKLCQLLEEYTQILVAAADNVGSNQLQNIRRGLRGDSVVLMGKNTMMKRTIRMHAEKTGNTAFLNLIPLLQGNVGLIFTKGDLXXXXXXXXXXXXGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINR 643
            M +K +KAEKKIAYD KLC LL+EYT++L+A ADNVGS QLQ+IRRGLRGDSVVLMGKNT+++R I+++AEKTGN  F  L+ LL GNVGLIFTKGDL            GAPARVGLVAP+DVVVPPGNTGLDPSQTSFFQVLNIPTKIN+
Sbjct:    1 MAIKRTKAEKKIAYDKKLCSLLDEYTKVLIALADNVGSKQLQDIRRGLRGDSVVLMGKNTLIRRCIKVYAEKTGNHTFDPLMDLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVAPVDVVVPPGNTGLDPSQTSFFQVLNIPTKINK 152          

HSP 2 Score: 48.521 bits (114), Expect = 3.038e-65
Identity = 23/27 (85.19%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  640 QGTVEIITPVELIRKGDKVGSSEAALL 720
            +GTVEIITPVELI+KG+KVGSSE+ALL
Sbjct:  152 KGTVEIITPVELIKKGEKVGSSESALL 178          
BLAST of FC931234 vs. ExPASy Swiss-Prot
Match: RLA0_CHERU (60S acidic ribosomal protein P0 OS=Chenopodium rubrum PE=2 SV=1)

HSP 1 Score: 221.476 bits (563), Expect = 1.494e-64
Identity = 113/152 (74.34%), Postives = 124/152 (81.58%), Query Frame = 2
Query:  188 MVVKASKAEKKIAYDAKLCQLLEEYTQILVAAADNVGSNQLQNIRRGLRGDSVVLMGKNTMMKRTIRMHAEKTGNTAFLNLIPLLQGNVGLIFTKGDLXXXXXXXXXXXXGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINR 643
            M VK +KAEKKIAYD KLCQLL+EY+Q+L+A+ADNVGSNQLQ IR GLRGDS+VLMGKNTMMKR+IR+HAE TGN    N+  L   NVGLIFTKGDL            GAPAR GLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKIN+
Sbjct:    1 MAVKPTKAEKKIAYDQKLCQLLDEYSQVLIASADNVGSNQLQAIRIGLRGDSIVLMGKNTMMKRSIRLHAENTGNENLRNVEQLFLPNVGLIFTKGDLNQVREEISKYKVGAPARFGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINK 152          

HSP 2 Score: 46.595 bits (109), Expect = 1.494e-64
Identity = 23/27 (85.19%), Postives = 26/27 (96.30%), Query Frame = 1
Query:  640 QGTVEIITPVELIRKGDKVGSSEAALL 720
            +GTVEIIT VELI+KG+KVGSSEAALL
Sbjct:  152 KGTVEIITAVELIKKGEKVGSSEAALL 178          
BLAST of FC931234 vs. ExPASy Swiss-Prot
Match: RLA0_CERCA (60S acidic ribosomal protein P0 OS=Ceratitis capitata GN=RpLP0 PE=3 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 1.855e-39
Identity = 75/156 (48.08%), Postives = 101/156 (64.74%), Query Frame = 2
Query:  191 VVKASKAEKKIAYDAKLCQLLEEYTQILVAAADNVGSNQLQNIRRGLRGDSVVLMGKNTMMKRTIRMHAEKTGNTAFLNLIPLLQGNVGLIFTKGDLXXXXXXXXXXXXGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINRVLLKL 658
            +V+ +KA  K  Y  K+ +L +EY +  +  ADNVGS Q+QNIR  LRG  VVLMGKNTMM++ IR H E   N     L+P ++GNVG +FTKGDL             APAR G +AP+ V++P  NTGL P +TSFFQ L+IPTKI++  +++
Sbjct:    1 MVRENKAAWKAQYFLKVVELFDEYPKCFIVGADNVGSKQMQNIRTSLRGLGVVLMGKNTMMRKAIRGHLEN--NAQLEKLLPHIKGNVGFVFTKGDLAEVRDKLLESKVRAPARAGAIAPLPVIIPAQNTGLGPEKTSFFQALSIPTKISKGTIEI 154          

HSP 2 Score: 36.965 bits (84), Expect = 1.855e-39
Identity = 16/27 (59.26%), Postives = 22/27 (81.48%), Query Frame = 1
Query:  640 QGTVEIITPVELIRKGDKVGSSEAALL 720
            +GT+EII  V +++ GDKVG+SEA LL
Sbjct:  149 KGTIEIINDVPILKPGDKVGASEATLL 175          
BLAST of FC931234 vs. ExPASy Swiss-Prot
Match: RLA0_DROME (60S acidic ribosomal protein P0 OS=Drosophila melanogaster GN=RpLP0 PE=1 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 9.074e-39
Identity = 74/156 (47.44%), Postives = 102/156 (65.38%), Query Frame = 2
Query:  191 VVKASKAEKKIAYDAKLCQLLEEYTQILVAAADNVGSNQLQNIRRGLRGDSVVLMGKNTMMKRTIRMHAEKTGNTAFLNLIPLLQGNVGLIFTKGDLXXXXXXXXXXXXGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINRVLLKL 658
            +V+ +KA  K  Y  K+ +L +E+ +  +  ADNVGS Q+QNIR  LRG +VVLMGKNTMM++ IR H E   N     L+P ++GNVG +FTKGDL             APAR G +AP+ V++P  NTGL P +TSFFQ L+IPTKI++  +++
Sbjct:    1 MVRENKAAWKAQYFIKVVELFDEFPKCFIVGADNVGSKQMQNIRTSLRGLAVVLMGKNTMMRKAIRGHLEN--NPQLEKLLPHIKGNVGFVFTKGDLAEVRDKLLESKVRAPARPGAIAPLHVIIPAQNTGLGPEKTSFFQALSIPTKISKGTIEI 154          

HSP 2 Score: 36.965 bits (84), Expect = 9.074e-39
Identity = 16/27 (59.26%), Postives = 22/27 (81.48%), Query Frame = 1
Query:  640 QGTVEIITPVELIRKGDKVGSSEAALL 720
            +GT+EII  V +++ GDKVG+SEA LL
Sbjct:  149 KGTIEIINDVPILKPGDKVGASEATLL 175          
The following BLAST results are available for this feature:
BLAST of FC931234 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 36
Match NameE-valueIdentityDescription
RLA0_SOYBN9.721e-7380.9260S acidic ribosomal protein P0 OS=Glycine max PE=... [more]
RLA01_ARATH2.813e-7280.2660S acidic ribosomal protein P0-1 OS=Arabidopsis t... [more]
RLA02_ARATH3.668e-7280.7960S acidic ribosomal protein P0-2 OS=Arabidopsis t... [more]
RLA03_ARATH1.061e-7180.1360S acidic ribosomal protein P0-3 OS=Arabidopsis t... [more]
RLA0_LUPLU1.510e-7080.2660S acidic ribosomal protein P0 OS=Lupinus luteus ... [more]
RLA0_ORYSJ3.056e-6873.0360S acidic ribosomal protein P0 OS=Oryza sativa su... [more]
RLA0_MAIZE3.038e-6573.0360S acidic ribosomal protein P0 OS=Zea mays GN=RP-... [more]
RLA0_CHERU1.494e-6474.3460S acidic ribosomal protein P0 OS=Chenopodium rub... [more]
RLA0_CERCA1.855e-3948.0860S acidic ribosomal protein P0 OS=Ceratitis capit... [more]
RLA0_DROME9.074e-3947.4460S acidic ribosomal protein P0 OS=Drosophila mela... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34103A01EF PostHarvP1 Citrus clementina cDNA clone C34103A01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931234 ID=FC931234|Name=FC931234|organism=Citrus clementina|type=EST|length=720bp
GAGCCTCCCAGATAATACTAGGGTTTTTCTTGTACACTTCTTTCACTCTC
TTTGTATCTCGTTGAGGTTAAAGAGACGGCAACTCCGCTGCTGTCCGCCT
TGGCAAGCCGCTGCTTCGTCTTGGCCCTCGATTTTGTATAAATTTACAAC
TTTTTACCACCAACAAAAGTAGAACCAAATCCACGAAATGGTAGTGAAAG
CATCGAAGGCCGAGAAGAAGATCGCGTACGACGCGAAGCTATGCCAGTTG
CTGGAAGAGTACACCCAAATCTTGGTGGCGGCCGCCGACAACGTGGGGTC
CAATCAACTCCAGAACATTCGTAGGGGTCTGCGTGGAGACTCCGTTGTGC
TAATGGGAAAGAACACTATGATGAAGAGGACTATCAGAATGCACGCTGAG
AAGACCGGTAACACTGCCTTTCTCAATCTCATCCCCCTCCTTCAGGGCAA
TGTTGGGTTGATTTTCACAAAGGGTGATTTGAAGGAAGTGAAAGAGGAGG
TTGCTAAGTACAAGGTTGGAGCTCCTGCTCGTGTTGGTTTGGTTGCTCCA
ATTGATGTGGTTGTTCCTCCCGGCAACACAGGTCTCGACCCCTCCCAGAC
CTCCTTCTTCCAGGTGCTTAACATTCCCACCAAGATTAACAGGGTACTGT
TGAAATTATCACACCTGTGGAGCTTATCAGGAAGGGTGACAAGGTGGGAT
CTTCTGAGGCAGCCCTGCTT
back to top